KEGG   Mus pahari (shrew mouse): 110314652
Entry
110314652         CDS       T05929                                 

Definition
(RefSeq) interferon-inducible protein AIM2-like
  KO
K12966  absent in melanoma 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110314652
   04623 Cytosolic DNA-sensing pathway
    110314652
SSDB
Motif
Pfam: HIN
Other DBs
NCBI-GeneID: 110314652
NCBI-ProteinID: XP_021044566
LinkDB
Position
Unknown
AA seq 268 aa
MLSHPQXXQMVAEQEAIREXLQKDPLVVMVLKAIHPFECETQEGRQEIFHATVATDTDFF
FVKVLNAQFKDKFIPKXTIKISNYLWHSNFMEVTSSSVVVDVESNYEVPHNIIKRAGETP
KISKLKTQPCGTIVNGLFKVQKGKRSNAFTLLRGKETCYGFYMHSPRCGTIRRCSLLELG
GRKLALYHMGRDESSSGVQVEKNQSKAECIVGVLGNATRTEKGIYNLLHEDEFYWLKNSA
QGKDYRDWMKETEKSEGDRCGLALQIAQ
NT seq 807 nt   +upstreamnt  +downstreamnt
atgctgagtcatcctcagaanaancagatggtggcagaacaggaagccatcagagaagan
ttacagaaagatccacttgtagtcatggtgctgaaagctatacatccctttgagtgtgag
acccaggaaggaagacaagagatatttcatgcaacagtggccacagacacagattttttc
tttgtaaaagttttaaatgcacagtttaaagataaatttattccaaaganaacaattaaa
atatcaaactacctttggcacagtaacttcatggaggtcaccagttcctcagttgtggtn
gatgttgaatctaactacgaagtcccacataacattattaagagagcaggagaaactccc
aagattagtaaactgaagactcagccatgtggaacaattgtgaatggactgtttaaagtc
cagaagggaaagagaagcaacgcttttactcttcttcgtggcaaagaaacctgttatggt
ttctatatgcacagcccaaggtgtggtactattagaaggtgtagccttcttgaattaggt
gggagaaaacttgccttgtaccacatgggtcgagatgagagttcttcaggagtccaagta
gagaaaaatcagagtaaagctgaatgcattgtgggtgtcttaggcaatgccaccagaact
gagaagggcatatataacctcctccatgaagatgagttctattggctgaaaaacagtgct
caaggtaaggattacagagactggatgaaagaaactgaaaagtctgagggagacaggtgt
ggcctggccctacagatagctcagtga

DBGET integrated database retrieval system