KEGG   Mus pahari (shrew mouse): 110314893
Entry
110314893         CDS       T05929                                 

Gene name
Raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah04270  Vascular smooth muscle contraction
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04613  Neutrophil extracellular trap formation
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04929  GnRH secretion
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05132  Salmonella infection
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110314893 (Raf1)
   04012 ErbB signaling pathway
    110314893 (Raf1)
   04014 Ras signaling pathway
    110314893 (Raf1)
   04015 Rap1 signaling pathway
    110314893 (Raf1)
   04370 VEGF signaling pathway
    110314893 (Raf1)
   04371 Apelin signaling pathway
    110314893 (Raf1)
   04630 JAK-STAT signaling pathway
    110314893 (Raf1)
   04068 FoxO signaling pathway
    110314893 (Raf1)
   04072 Phospholipase D signaling pathway
    110314893 (Raf1)
   04071 Sphingolipid signaling pathway
    110314893 (Raf1)
   04024 cAMP signaling pathway
    110314893 (Raf1)
   04022 cGMP-PKG signaling pathway
    110314893 (Raf1)
   04151 PI3K-Akt signaling pathway
    110314893 (Raf1)
   04150 mTOR signaling pathway
    110314893 (Raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110314893 (Raf1)
  09143 Cell growth and death
   04210 Apoptosis
    110314893 (Raf1)
   04218 Cellular senescence
    110314893 (Raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110314893 (Raf1)
   04540 Gap junction
    110314893 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110314893 (Raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110314893 (Raf1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110314893 (Raf1)
   04625 C-type lectin receptor signaling pathway
    110314893 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    110314893 (Raf1)
   04660 T cell receptor signaling pathway
    110314893 (Raf1)
   04662 B cell receptor signaling pathway
    110314893 (Raf1)
   04664 Fc epsilon RI signaling pathway
    110314893 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    110314893 (Raf1)
   04062 Chemokine signaling pathway
    110314893 (Raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110314893 (Raf1)
   04929 GnRH secretion
    110314893 (Raf1)
   04912 GnRH signaling pathway
    110314893 (Raf1)
   04915 Estrogen signaling pathway
    110314893 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    110314893 (Raf1)
   04917 Prolactin signaling pathway
    110314893 (Raf1)
   04921 Oxytocin signaling pathway
    110314893 (Raf1)
   04926 Relaxin signaling pathway
    110314893 (Raf1)
   04935 Growth hormone synthesis, secretion and action
    110314893 (Raf1)
   04919 Thyroid hormone signaling pathway
    110314893 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    110314893 (Raf1)
   04916 Melanogenesis
    110314893 (Raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    110314893 (Raf1)
  09156 Nervous system
   04726 Serotonergic synapse
    110314893 (Raf1)
   04720 Long-term potentiation
    110314893 (Raf1)
   04730 Long-term depression
    110314893 (Raf1)
   04722 Neurotrophin signaling pathway
    110314893 (Raf1)
  09158 Development and regeneration
   04360 Axon guidance
    110314893 (Raf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110314893 (Raf1)
   05206 MicroRNAs in cancer
    110314893 (Raf1)
   05205 Proteoglycans in cancer
    110314893 (Raf1)
   05230 Central carbon metabolism in cancer
    110314893 (Raf1)
   05231 Choline metabolism in cancer
    110314893 (Raf1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110314893 (Raf1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110314893 (Raf1)
   05212 Pancreatic cancer
    110314893 (Raf1)
   05225 Hepatocellular carcinoma
    110314893 (Raf1)
   05226 Gastric cancer
    110314893 (Raf1)
   05214 Glioma
    110314893 (Raf1)
   05221 Acute myeloid leukemia
    110314893 (Raf1)
   05220 Chronic myeloid leukemia
    110314893 (Raf1)
   05218 Melanoma
    110314893 (Raf1)
   05211 Renal cell carcinoma
    110314893 (Raf1)
   05219 Bladder cancer
    110314893 (Raf1)
   05215 Prostate cancer
    110314893 (Raf1)
   05213 Endometrial cancer
    110314893 (Raf1)
   05224 Breast cancer
    110314893 (Raf1)
   05223 Non-small cell lung cancer
    110314893 (Raf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110314893 (Raf1)
   05022 Pathways of neurodegeneration - multiple diseases
    110314893 (Raf1)
  09165 Substance dependence
   05034 Alcoholism
    110314893 (Raf1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110314893 (Raf1)
   05152 Tuberculosis
    110314893 (Raf1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110314893 (Raf1)
   05161 Hepatitis B
    110314893 (Raf1)
   05160 Hepatitis C
    110314893 (Raf1)
   05164 Influenza A
    110314893 (Raf1)
   05163 Human cytomegalovirus infection
    110314893 (Raf1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110314893 (Raf1)
   05165 Human papillomavirus infection
    110314893 (Raf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110314893 (Raf1)
   01522 Endocrine resistance
    110314893 (Raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110314893 (Raf1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110314893 (Raf1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   110314893 (Raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal RA C1_2
Other DBs
NCBI-GeneID: 110314893
NCBI-ProteinID: XP_021044750
Ensembl: MGP_PahariEiJ_G0022506
LinkDB
Position
2
AA seq 668 aa
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPAPPSFPMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLHVDSRMIESNSLNASPRACSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYAHINNRDQIIFMVGRGYASPDLSRLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggtgcttggaagacgatcagcaatggctttggactcaaagatgca
gtgtttgatggctccagctgcatctcccctaccattgttcagcagtttggctatcagcgc
cgggcctcagatgatggcaaactcacggattcttctaagacaagcaatactatccgggtt
ttcttgccaaataagcaaaggactgtggtcaatgtgcggaatggaatgagcttgcacgac
tgccttatgaaggctctgaaggtgagaggcctgcagccagagtgctgtgcagtgttcaga
ctcctccaggaacacaaaggtaagaaagcacgcttagattggaacaccgatgccgcctct
ctgattggagaagaactgcaagtggattttttggatcatgttccactcacaactcacaac
tttgctcggaaaacgttcctgaagcttgcattctgtgacatctgtcagaagttcctgcta
aatggatttcgatgtcagacttgtggctacaagtttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttgctgtttccaaattccact
gttggtgacagtggagtcccagcaccaccttctttcccaatgcgtcggatgcgagaatct
gtttcccggatgcctgctagttcccagcacagatactccacaccccatgccttcactttc
aacacctccagcccttcctcggaaggttccctgtcccagaggcagaggtcaacgtccact
cccaatgtccacatggtcagcaccaccctgcatgtggacagcaggatgattgagagtaac
agcctgaatgcttctcccagggcgtgctccagacgattttgtctgaggggaagagatgca
attcgaagtcacagtgaatcagcctcaccttcagccctgtccagcagcccaaacaacctg
agtccaacaggctggtcacagcccaaaacccctgtgccagcacaaagagagcgggcacca
ggatctgggacccaggaaaaaaacaaaattaggcctcgtgggcaaagagattcaagttat
tactgggaaatagaagccagtgaggtgatgctgtctactcggatcgggtcaggctccttt
ggcactgtgtacaagggcaagtggcatggagatgttgcagtaaagatcctaaaggtggtt
gacccaactccagagcaacttcaggccttcaggaacgaggtggctgttttgcgcaaaaca
cggcacgtcaacatcctgctgttcatggggtacatgacaaaggacaacctggccattgtg
acccagtggtgtgagggcagcagtctctacaaacacctacatgtccaggagaccaaattc
cagatgttccagctaattgacattgcccgacagacagctcagggaatggactatttgcat
gcaaagaacatcattcacagagacatgaaatccaacaacatatttctccatgaaggcctc
acggtgaaaattggagattttggtttggcaacagtgaagtcacgctggagtggttctcag
caggttgaacagcccactggctctgtgctgtggatggccccagaagtaatccggatgcag
gataacaacccgttcagcttccagtctgacgtctactcctatggcattgtgctgtacgag
ctgatgaccggggagcttccctatgcccacatcaacaacagagaccagatcatcttcatg
gtaggccgtgggtatgcctccccagatctcagcaggctctacaagaactgcccaaaggca
atgaagaggttggtggctgactgtgtgaagaaagtcaaagaagagagacctttgtttccc
cagatcctatcttccatcgagctgcttcagcactctctgccgaaaatcaacaggagcgcc
tctgagccgtccctgcatcgggcagctcacactgaggacatcaatgcgtgcacgctgact
acatccccaaggctaccagtcttctag

DBGET integrated database retrieval system