KEGG   Mus pahari (shrew mouse): 110315272
Entry
110315272         CDS       T05929                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4C-like
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110315272
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mpah04054]
    110315272
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110315272
Pattern recognition receptors [BR:mpah04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110315272
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH AAA_16 AAA_30
Other DBs
NCBI-GeneID: 110315272
NCBI-ProteinID: XP_021045021
LinkDB
Position
Unknown
AA seq 640 aa
MASFFSDFGLMWYLEELNKKEFMKFKEFFKQEILQLRLKQISWTEVKKASREDLANLLLK
HYEEKQSWDMTFKIFQKMNRKDLXERAGREIAGHSKFYQAHLKKRLTHDYARKFNIKDQD
SLKQKFTQDDCDHFENLLVSKATGKKPHMVFLQGAAGIGKSLMLTKLMIAWSEGVVFQNK
FSYIFYFCCQDVKTLKRASLAELISKEWPSPSAPIEEIXXQPEKLLFVIDSLEVMECDMS
ERESELCDSCTERQPVAVLLSSLLRRKMLPESSLLISATPEAFEKMEDRVECTNVKIVTG
FNESNIKLYFRSLFQDKTKTQEIFSLVKENQQLFTVCQVPVLCWMVAACLKKEIEKGRDP
VSVCRRTTSLYTTHIYNLFIPQSAHSPSKKSQDQLQGLCSLAAEGMWADTFVFNEEALRR
NGIMDADIPTLLDIRILEKSKESEKSYVFLHPSIQEVCAAIFYLLKSHXDHPSQDVKSIE
MVMFTFLKKVKVQWIFWGSFIFGLLHESEQKKLEVFFGLQLSQEIKHQLYQCLDTISGNE
ELQEQIDGMKLFYCLFEMDDEVVLVQAMKCMEQINFVAKDYSDVIVAAHCLKHCSTLKKL
SFSTQNILSEGQEHNYTISLCSCGKSGTLISTCLSAESWN
NT seq 1923 nt   +upstreamnt  +downstreamnt
atggcatcattcttttctgattttggccttatgtggtacttggaagagctaaacaagaaa
gaattcatgaagtttaaggaattcttcaaacaggagattttgcagttgaggctgaaacag
atttcttggaccgaagtgaagaaggcatctcgtgaagaccttgccaacttactgttaaaa
cattatgaagagaagcaatcctgggatatgaccttcaaaatcttccagaagatgaatagg
aaggatctcatngagagggcaggaagagagattgctggacactccaagttctatcaagct
cacttgaagaagaggctgacccatgattatgccagaaagtttaacatcaaagatcaagat
tcccttaagcagaaatttacccaggatgactgtgatcattttgagaaccttcttgtatca
aaggcgactggaaagaagccacacatggtgttcctgcaaggagcggcgggaattggcaag
tcactgatgttgacaaagttaatgattgcctggtcagaaggcgtggtgtttcagaacaaa
ttctcctacatcttctacttctgctgtcaagatgtgaagacgttgaagagagcaagcctg
gcagaattgatctccaaagagtggcccagcccctcagctcccatagaggagatcntancc
caaccngagaaactcttatttgtcatcgacagcttggaagtgatggaatgtgatatgtcc
gaacgggagtcggagctgtgtgatagctgcacggagaggcagccggtggctgtactgctg
agcagtttgctcaggaggaagatgctccctgaatcctctctcctcatctctgctacccca
gaggcttttgagaaaatggaggacagggttgagtgcacaaatgtgaaaatagtaacagga
ttcaatgagagcaatattaagttgtatttccgcagcttgttccaagataagaccaaaacc
caggaaatcttcagtttggtgaaagaaaaccagcagctgttcactgtctgtcaggtccct
gtgctctgctggatggtggctgcctgtctgaaaaaagagatagagaagggaagagaccca
gtctccgtctgccgacgtaccacctccctgtataccactcacatctacaatttgttcatt
ccccaaagtgcccattctccaagtaagaaaagccaagaccagctgcagggcttgtgttct
ctggccgctgagggcatgtgggctgacacatttgtgtttaatgaggaggctctcaggaga
aatgggatcatggacgctgacatccccacactgctggatataaggatccttgaaaagagc
aaggaatctgaaaaatcttacgttttcctccacccntctatccaggaggtctgtgcagcc
atcttttatctgctaaagagccacntggaccaccctagccaggatgttaaaagtatagag
atggtcatgtttacatttctaaagaaagtcaaagtacagtggattttttggggctctttc
atctttggccttttacatgaatcagaacaaaaaaagctagaggtgttttttggcctgcag
ttgtcccaggaaataaagcatcagttgtatcagtgcctggacaccataagtggcaatgaa
gagcttcaagagcagatagatggcatgaagttattttactgtctgtttgagatggacgat
gaagtcgtcttagtacaagcaatgaagtgtatggaacagattaactttgtggctaaggat
tattctgatgttattgttgctgcccactgcttaaaacactgttcgacactgaagaaacta
tccttctcaacccaaaatattctgagtgaaggtcaagaacacaactatacgatctcacta
tgtagctgtggcaagtctggaactctaatatccacctgcctgtctgcagagtcctggaat
taa

DBGET integrated database retrieval system