KEGG   Mus pahari (shrew mouse): 110315813
Entry
110315813         CDS       T05929                                 

Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4A-like
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110315813
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mpah04054]
    110315813
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   Others
    110315813
Pattern recognition receptors [BR:mpah04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   110315813
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH AAA_16 AAA_22 NB-ARC AAA_14
Other DBs
NCBI-GeneID: 110315813
NCBI-ProteinID: XP_021045438
LinkDB
Position
Unknown
AA seq 725 aa
MASFFSDFGLMWYLEELNKKEFMNFKGFLKQEILQLGLKQISWPEVRKASREELANLLLK
HYEEKQTWDMTFNIFQKLNRKDLIERAESELAGHPKLYRDHLKTKVTHYDFRAFNISIQD
FFRKKFTKDDSDYFENLLLSQRTEMKPHMVFMYGVAGIGKTLLLKKFMLAWLEGQVIQNK
FSYIFYFCCQDLKQLKTASLADLISREWPSPSAPIEEILSQPEKLLFIIDSLERMECDLL
EQESELCDNCMEKKPVNILISSLLRRKILPQSSILISATPGKFEKIQDMIECTDVKIIKG
FKERHIKTYFHIMIHDRNKAQEAFSLVRENEQLFTLCQAPVLCWMVITCLKNEIEKGRDP
VSICQRTTSLYTTHIFNLFIPQSAQYPSKESQAQLQSLCSLAAEGMWTDTFMFNEEALRR
NGIVDSDIPTLLDIGMLGKIRESENFYIFLHPSVQEVCAAIFYLLKSHDDHPSQDVKCIE
TLMFMFLTKVKVQWVFLGCFIFGLLHKSELEKLEVFFGYHLSQKIKDKLYQYLETISGNE
DLQEEIDGMKFFSCLFELDDEAFLVQAMNCMEQIRFMAKDYSDIIIAANCLKHCSTLKKL
SFSTENVLIEELEKSYMEKVLDCWNHMCSVFIRSKDIEVLQIKDTNFKEKIFQVLYESLM
YPSFTLKGLMINNVTFFDGEHMFFELIQNCSLEYLNLSRSFLSPREVKQLCEILIQAECK
MEKLV
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcatcattcttttctgactttggtctcatgtggtacttggaagagttaaacaagaag
gaatttatgaattttaaaggattcctcaaacaggagattttacaattggggctgaaacag
atttcttggccagaagtgaggaaggcatctcgggaagaacttgccaacttactgttgaaa
cattatgaagagaagcaaacctgggatatgaccttcaatattttccagaagctcaacagg
aaggatctcatcgagagggcagaaagtgaacttgctggacacccaaagttatatagagat
catttgaagacaaaggtgacccattatgatttcagagcattcaacattagtattcaggat
ttctttaggaagaaatttaccaaggatgacagtgattattttgagaaccttctcctatca
cagagaactgaaatgaagccacacatggtattcatgtatggtgttgctggaattggcaag
acactgttgttgaagaagtttatgcttgcctggttagaaggtcaggtgattcagaataaa
ttttcctacatcttctacttctgctgtcaagatttgaagcagttgaagacagctagcctg
gctgatctgatctccagagagtggcccagtccctcagctcccatagaggagatactatca
caacctgagaaactcttatttatcattgacagcttggaacgaatggaatgtgatttgttg
gaacaggaatctgagctgtgtgataactgcatggagaagaagccagtgaatatactgata
agcagtttgctcaggagaaagattctccctcaatcctctatccttatctctgctacccca
ggtaaatttgagaaaatacaggacatgattgagtgcacagatgtgaaaataataaaggga
ttcaaggagaggcatattaaaacatatttccacatcatgatccatgacagaaacaaagcc
caggaagccttcagtttggtgagagaaaatgagcagctgttcactctatgtcaggctcct
gtgctctgctggatggtgattacttgtcttaaaaatgagatagagaagggtagagaccca
gtctccatttgccaacgtaccacctccctgtataccactcacatcttcaatttgttcatt
ccccaaagtgcccaatatccaagtaaggaaagccaagctcagcttcagagcttgtgttct
ctggctgctgagggtatgtggactgacacatttatgtttaacgaggaggctctcagaaga
aatgggatcgtggactctgacatccccacactgctggacattggaatgcttggaaagatc
agggaatctgaaaacttttacatattcctccacccatctgtccaagaggtctgtgctgcc
atattttatctgctaaagagccatgatgaccaccctagtcaggatgtgaaatgtatagag
acactcatgtttatgtttctaacgaaagtcaaagtacagtgggtttttttgggatgtttc
atctttggtcttttacataagtcagaactagaaaagctagaagtgttttttggctaccat
ttgtcccagaaaataaaggataagttgtatcagtacctggaaaccataagtggcaatgaa
gaccttcaagaagaaattgatggcatgaaatttttttcttgtctgtttgagttggatgat
gaagccttcttagtacaagcaatgaactgtatggaacagattaggtttatggctaaggat
tattctgatattattattgctgccaactgcttaaaacactgttctacactgaagaaacta
tccttttcaactgaaaatgtcctgattgaagaactagaaaaaagctatatggaaaaggta
cttgactgttggaatcatatgtgctctgtgttcataaggagtaaagacatcgaggtactc
caaataaaagacactaatttcaaagagaaaatctttcaggtcttgtatgaatctctgatg
taccccagcttcacccttaaaggacttatgataaataacgtgaccttctttgatggtgag
cacatgttctttgagttgattcagaactgcagtttagagtacttgaacctcagccgttca
ttcctctcccccagggaggtgaaacagttgtgtgaaatcttaattcaggcagagtgcaag
atggaaaaactggtgtaa

DBGET integrated database retrieval system