KEGG   Mus pahari (shrew mouse): 110315942
Entry
110315942         CDS       T05929                                 

Gene name
Mob1a
Definition
(RefSeq) MOB kinase activator 1A isoform X1
  KO
K06685  MOB kinase activator 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110315942 (Mob1a)
   04392 Hippo signaling pathway - multiple species
    110315942 (Mob1a)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 110315942
NCBI-ProteinID: XP_021045593
Ensembl: MGP_PahariEiJ_G0022289
LinkDB
Position
2
AA seq 216 aa
MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN
TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
NT seq 651 nt   +upstreamnt  +downstreamnt
atgagcttcctcttcagcagccgctcttcgaaaacattcaaaccaaagaagaatattcct
gaagggtcccatcagtatgaactcttaaagcatgcagaggcaactctcggaagtggcaat
ctgaggcaagctgttatgttgcctgagggagaggacctcaatgaatggattgctgttaat
actgtggatttcttcaatcagatcaacatgttgtatggaaccattacagaattctgcact
gaggcaagctgcccagtcatgtcagcaggtcccaggtatgaataccactgggcagatggc
actaatattaaaaagccaattaagtgttctgcaccaaaatatattgactatttgatgact
tgggttcaggatcagcttgatgacgaaacactttttccttctaagattggtgtcccattt
cccaaaaactttatgtctgtggcaaagactattctgaagcgtctcttcagggtttatgcc
catatttaccaccagcactttgactctgtgatgcagctgcaagaggaggcccacctcaac
acctcctttaagcactttattttctttgttcaggagtttaatctgattgataggcgtgag
ttggcaccacttcaggaattaattgagaagcttggatctaaagacagataa

KEGG   Mus pahari (shrew mouse): 110330335
Entry
110330335         CDS       T05929                                 

Gene name
Mob1b
Definition
(RefSeq) MOB kinase activator 1B
  KO
K06685  MOB kinase activator 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110330335 (Mob1b)
   04392 Hippo signaling pathway - multiple species
    110330335 (Mob1b)
SSDB
Motif
Pfam: Mob1_phocein
Other DBs
NCBI-GeneID: 110330335
NCBI-ProteinID: XP_021065989
Ensembl: MGP_PahariEiJ_G0017156
LinkDB
Position
13
AA seq 203 aa
MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVN
SKSPLCFWQTLSWVSDLLRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFP
SKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEF
NLIDRRELAPLQELIEKLTSKDR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgagcttcttgtttggtagtcgctcttctaaaacttttaaaccaaagaagaacatacca
gaggggtctcaccagtatgaactcttaaagcatgcagaagccacactgggcagtggcaac
ctgcggatggctgtcatgcttcctgagggagaggacctgaatgagtgggttgcagttaac
agtaagtcacccttgtgtttctggcagactctgagttgggtcagtgaccttcttagatat
gaatatcactgggcagatggaacaaacataaaaaagcccattaagtgttctgcaccaaag
tatattgattacttgatgacttgggttcaggaccagctggatgatgagacattatttcca
tcaaaaattggtgttccattcccgaagaatttcatgtctgtggcaaaaacaatactcaaa
cgcctctttagagtttatgctcatatttatcaccaacattttgaccctgtgatccagctt
caggaggaagcacatctcaatacatctttcaagcactttatttttttcgttcaggagttc
aaccttattgacagacgagagttggcaccactgcaagagctgattgaaaaactcacctca
aaggatagataa

DBGET integrated database retrieval system