KEGG   Mus pahari (shrew mouse): 110315959
Entry
110315959         CDS       T05929                                 

Gene name
Tead4
Definition
(RefSeq) transcriptional enhancer factor TEF-3 isoform X1
  KO
K09448  transcriptional enhancer factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110315959 (Tead4)
   04392 Hippo signaling pathway - multiple species
    110315959 (Tead4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110315959 (Tead4)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    110315959 (Tead4)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 110315959
NCBI-ProteinID: XP_021045632
Ensembl: MGP_PahariEiJ_G0022666
LinkDB
Position
2
AA seq 361 aa
MYGRNELIARHIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKNKALQSMAAM
SSAQIVSATAFHSKMALARGPGYPAISGFWQGALPGQPGTSHDVKPFSQNTYTVQPPLPL
PGFESPVGPTPSPSAPPAPPWQGRSIASSKLWMLEFSAFLERQQDPDTYSKHLFVHISQS
SPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPPNAFFLVKFWADLNTNIDDEGSAF
YGVSSQYESLENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINF
IHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVK
E
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtatggtcggaatgagctgatcgcacgccacatcaagctccggacagggaagacgcgc
acaaggaagcaggtctccagccacattcaggtgcttgcccgtcgaaaagcccgggagatc
caggccaaactcaaggaccaggcagctaagaacaaggccctgcagagcatggctgccatg
tcgtccgcccagatcgtctcggctacagccttccacagtaaaatggctcttgcccggggc
cctggctacccagcaatctcagggttttggcaaggagctttgccaggccaacctggaaca
tcccacgatgtgaaacctttctctcaaaacacctacactgtccagcctccgctgcctctg
ccaggctttgagtcacctgtaggacccaccccatcgccctccgcaccgcccgctcctccg
tggcaaggccgcagcatagctagctccaagctctggatgttggagttctccgctttcctg
gagcgccagcaagatcccgacacatacagcaaacacctgttcgttcacatcagccagtca
agcccaagctacagtgacccctacctcgaaaccgtggacatccgccaaatctatgacaag
ttcccagagaagaagggaggcctcaaggagctatttgaacggggaccccctaatgccttc
ttccttgtgaagttctgggcagacctcaataccaacatcgatgatgagggcagcgcattc
tatggggtctccagccagtatgagagcctggagaacatgattattacctgctctactaag
gtctgctcgtttggcaagcaagtggtggagaaagttgagacggagtatgcccgctatgag
aatggccactatttgtaccgcatccaccggtcccctctctgtgagtacatgatcaacttt
atccacaagctgaaacacttacccgagaagtacatgatgaacagtgtgctggagaacttc
accatcttgcaggtggtcaccaaccgggacacacaggagaccttgctgtgtattgcatat
gtcttcgaagtttcagccagcgagcacggggctcagcaccacatctaccggcttgtgaaa
gaatga

KEGG   Mus pahari (shrew mouse): 110319868
Entry
110319868         CDS       T05929                                 

Gene name
Tead2
Definition
(RefSeq) transcriptional enhancer factor TEF-4 isoform X1
  KO
K09448  transcriptional enhancer factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110319868 (Tead2)
   04392 Hippo signaling pathway - multiple species
    110319868 (Tead2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110319868 (Tead2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    110319868 (Tead2)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 110319868
NCBI-ProteinID: XP_021051195
Ensembl: MGP_PahariEiJ_G0012932
LinkDB
Position
1
AA seq 445 aa
MGDPRTGAPLDDGGGWTGSEEGSEEGTGGSEGVGGDGSPDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK
DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPSGPQATELFQFWSGSSGPPWNVPDVKPF
SQAPFSVSLTPPASDLPGYEPPPALSPLPPPEPSPPAWQARALGTARLQLVEFSAFVEPP
DAVDTFQRHLFVHISQQCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSAEEAWSSGGGGGFYGVSSQYESRELMTLTCSSKVCSFGKQVVEKVETER
AQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQELLL
CTAYVFEVSTSERGAQYHIYRLVRD
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgggggatccccggactggggcccccctggatgatggcgggggctggacaggtagcgag
gaaggcagcgaggagggcaccggaggcagcgagggcgttggaggtgacggcagccctgat
gcagaaggtgtgtggagccccgacattgagcagagttttcaggaggccctggccatctac
cctccctgtggccgtcgcaagatcatcctgtcagatgagggcaagatgtacggtcggaac
gaactcattgcccgttacatcaagctgaggacggggaagacgagaactcgaaagcaggtc
tccagccacatccaggttttggctcgaaggaaatcgagagaaattcagtccaagctgaag
gaccaagtctccaaggacaaggccttccagacaatggccaccatgtcttcggcacagctc
atctccgccccttccctccaggctaagctgggtccttctggccctcaggccactgagctt
ttccagttctggtcagggagctctgggccaccatggaatgttccagatgtgaagcccttc
tcacaggcaccgttctccgtgtcactgacgcccccagcctctgacctaccagggtatgag
ccgcccccagccctctcacccctgcccccacccgagccgtctcccccagcctggcaggct
cgggccctgggcactgcccgcctgcagctggtagagttctcagcgtttgtggaacctcca
gatgcagttgacacgttccagaggcatctgtttgtccacatcagtcagcagtgtcctagc
cccggagcaccgcccctggagagtgtggacgtgcggcagatctacgacaagttccccgag
aagaagggcggcctccgggagctgtatgaccgagggccaccacacgccttcttcctagtc
aagttctgggcggacctgaactggggccccagtgccgaggaggcatggagcagcggaggt
ggcggtggcttctatggagtgagcagccagtatgagagccgggagctcatgacactcacc
tgctcctccaaggtctgctcctttggcaagcaagtggtagagaaggtggagacggagcgg
gcccagctggaggatgggcgctttgtgtaccgtctgctgcgctctcccatgtgtgagtac
ctggttaatttcctgcacaagctccgtcaactgcctgaacgctacatgatgaacagtgtc
ctggagaacttcaccatcctgcaggttgtgacaaacagggacactcaggaactgctgctg
tgtactgcctacgtctttgaagtctccaccagtgaacgcggagcccagtaccacatctac
cgcctggtcagggactga

KEGG   Mus pahari (shrew mouse): 110322324
Entry
110322324         CDS       T05929                                 

Gene name
Tead1
Definition
(RefSeq) transcriptional enhancer factor TEF-1 isoform X1
  KO
K09448  transcriptional enhancer factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110322324 (Tead1)
   04392 Hippo signaling pathway - multiple species
    110322324 (Tead1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110322324 (Tead1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    110322324 (Tead1)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 110322324
NCBI-ProteinID: XP_021054616
Ensembl: MGP_PahariEiJ_G0013549
LinkDB
Position
1
AA seq 436 aa
MERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIAR
YIKLRTGKTRTRKQVSSHIQVLARKKVREIQAAIKVSSHIQVLARRKSRDFHSKLKVTSM
DQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGGPGFWPGMIQTGQPGSSQ
DVKPFVQQAYPIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRD
PDSYNKHLFVHIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKF
WADLNCNIQDDAGAFYGVSSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV
YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVS
NSEHGAQHHIYRLVKD
NT seq 1311 nt   +upstreamnt  +downstreamnt
atggaaaggatgagcgactcggcagataagccgattgacaacgacgcggagggcgtctgg
agtcctgatattgagcagagtttccaggaggccctggctatctatccaccgtgtgggagg
aggaagatcatcttatcagacgaaggcaaaatgtatggtagaaatgaattgatagccaga
tacatcaagctcaggacggggaagacaaggaccaggaagcaggtgtctagtcatatacag
gtcttagcaagaaagaaagttcgagaaattcaagccgccattaaggtgtctagtcacatt
caggttcttgccagaaggaaatctcgtgattttcattccaagctgaaggtaacaagcatg
gatcagactgccaaggacaaggccctgcagcacatggctgccatgtcatcagcccagatc
gtctcggctactgccatccacaacaagctggggctgcctgggattccgcgccccaccttc
ccagggggtccggggttctggcctgggatgatacagacaggacagccaggatcctcacaa
gacgtcaagccctttgtgcagcaggcctaccccatccagccagcagtcacagcccccatt
ccagggtttgagcctgcgtcagccccagccccctcagttcctgcctggcagggccgatcc
attggcacaaccaagcttcgcctggtggaattctccgctttccttgaacagcagagagac
ccagactcgtacaacaaacacctcttcgtgcacatcgggcatgccaaccattcttacagt
gacccgttgctcgaatctgtggacattcgtcagatatatgacaaatttcctgaaaagaaa
ggtggcttgaaggagctgtttggaaagggccctcaaaacgccttcttcctcgtcaaattc
tgggcggacttaaactgcaatatccaagacgatgccggggccttttatggtgtgagcagt
cagtatgagagttctgaaaacatgacggttacctgttccaccaaagtgtgttcctttggg
aaacaagtagtagaaaaagtagagacggagtatgcgaggttcgagaatggtcgattcgtg
taccgaataaaccgctcaccgatgtgtgaatatatgatcaacttcatccacaagctcaaa
cacctaccagagaaatatatgatgaacagtgttttggaaaacttcaccatattattggtg
gtaacaaacagggatacacaagaaactctgctctgcatggcctgtgtatttgaagtctcg
aatagtgaacacggagcacagcaccatatctacaggctcgtgaaggactga

KEGG   Mus pahari (shrew mouse): 110337942
Entry
110337942         CDS       T05929                                 

Gene name
Tead3
Definition
(RefSeq) transcriptional enhancer factor TEF-5
  KO
K09448  transcriptional enhancer factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110337942 (Tead3)
   04392 Hippo signaling pathway - multiple species
    110337942 (Tead3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110337942 (Tead3)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    110337942 (Tead3)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 110337942
NCBI-ProteinID: XP_021076728
Ensembl: MGP_PahariEiJ_G0023637
LinkDB
Position
21
AA seq 465 aa
MQLGGLARRGSGHPGGSGPEPKATSTIASNSWTANSSPGEAREDGSEGLDKGLDNDAEGV
WSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHI
QVLARKKVREYQVGIKAMNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAV
FSSSSRFWSSPPLLGQQPGPSQDVKPFAQPAYPIQPPLPPVLNSYESLAPLPPAAASATT
SAPAWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQ
IYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGTFYGVSSQYSSADSMTIS
VSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSV
LENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcaactcggaggcctcgcgcgcagaggctcaggccatccagggggctcaggcccagag
cccaaagcaaccagcacaatagcgtccaacagctggaccgccaacagcagccccggggag
gcccgggaagatgggtccgaaggcctggacaaggggctggacaacgatgccgagggagtg
tggagcccggacatcgagcagagctttcaggaggccctggccatctacccgccttgtggc
cggcgcaagatcatcctgtcagatgagggcaagatgtacggtcgaaatgagctgattgcc
cgctacatcaagctgaggactggaaaaaccaggacgagaaaacaggtgtccagccacata
caggttctagctcggaagaaggttcgggaataccaggttggcattaaggctatgaacctg
gaccaagtctccaaggacaaggctctccagagcatggcgtccatgtcgtctgcccaaatc
gtctctgccagcgttctacagaacaagttcagcccaccctcccccctcccccaggctgtc
ttctcctcctcctcaaggttctggagcagcccccctctgctaggacaacagcctggacct
tctcaggacgttaagcccttcgcacagcctgcctaccccatccagcctcccctgccaccg
gtgctcaacagttatgagtccctcgccccgctgcctccagccgctgcctcagccaccacc
tctgcgcctgcgtggcaggaccgcaccatcgcctcctcccggctacgcctcctggagtat
tctgccttcatggaggtgcaacgggaccctgacacgtacagcaaacacctgtttgtacac
atcggccagacaaaccctgccttctcagacccacccctggaggcagtggatgtacgacag
atctacgacaagttccccgagaagaagggggggctgaaggaactctatgagaaggggccc
ccgaacgctttcttccttgtcaagttctgggctgacctcaacagcacaatccaggaaggc
cctgggaccttctacggggtcagctcgcaatacagctcagctgacagcatgaccatcagc
gtctccaccaaggtgtgctcctttggcaagcaggtggtagagaaggtggagacggagtac
gcccgcctggagaacggccgctttgtgtaccgcatccaccgctcacccatgtgcgagtac
atgatcaacttcatccacaaactgaagcatctgcccgagaagtacatgatgaacagcgtg
ctggagaacttcaccatcctgcaggtggtcacaagtcgggactcgcaggagaccctgctg
gtcattgcttttgtctttgaagtctccaccagtgagcatggggcacagcaccatgtctac
aagcttgtcaaagactag

DBGET integrated database retrieval system