KEGG   Mus pahari (shrew mouse): 110315992
Entry
110315992         CDS       T05929                                 

Gene name
Rps6kb2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04350  TGF-beta signaling pathway
mpah04371  Apelin signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04931  Insulin resistance
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110315992 (Rps6kb2)
   04350 TGF-beta signaling pathway
    110315992 (Rps6kb2)
   04371 Apelin signaling pathway
    110315992 (Rps6kb2)
   04066 HIF-1 signaling pathway
    110315992 (Rps6kb2)
   04151 PI3K-Akt signaling pathway
    110315992 (Rps6kb2)
   04152 AMPK signaling pathway
    110315992 (Rps6kb2)
   04150 mTOR signaling pathway
    110315992 (Rps6kb2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110315992 (Rps6kb2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110315992 (Rps6kb2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110315992 (Rps6kb2)
  09149 Aging
   04211 Longevity regulating pathway
    110315992 (Rps6kb2)
   04213 Longevity regulating pathway - multiple species
    110315992 (Rps6kb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    110315992 (Rps6kb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110315992 (Rps6kb2)
   05205 Proteoglycans in cancer
    110315992 (Rps6kb2)
   05231 Choline metabolism in cancer
    110315992 (Rps6kb2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110315992 (Rps6kb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110315992 (Rps6kb2)
   05212 Pancreatic cancer
    110315992 (Rps6kb2)
   05225 Hepatocellular carcinoma
    110315992 (Rps6kb2)
   05226 Gastric cancer
    110315992 (Rps6kb2)
   05221 Acute myeloid leukemia
    110315992 (Rps6kb2)
   05224 Breast cancer
    110315992 (Rps6kb2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110315992 (Rps6kb2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110315992 (Rps6kb2)
   05163 Human cytomegalovirus infection
    110315992 (Rps6kb2)
   05165 Human papillomavirus infection
    110315992 (Rps6kb2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110315992 (Rps6kb2)
   01522 Endocrine resistance
    110315992 (Rps6kb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110315992 (Rps6kb2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110315992 (Rps6kb2)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110315992 (Rps6kb2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 110315992
NCBI-ProteinID: XP_021045703
Ensembl: MGP_PahariEiJ_G0013991
LinkDB
Position
1
AA seq 485 aa
MAAVFDLDLETEEGSEGEGEPEFSPADVCPLGELRAAGLETVGHYEEVELTESSVNLGPE
RIGPHCFELLSVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVCSAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLGEITL
ALGHLHSHGIIYRDLKPENIMLNSQGHIKLTDFGLCKESIHEGAITHTFCGTIEYMAPEI
LVRTGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIKGKLVLPPYLTPDARDLA
KKFLKRNPIQRIGGGPGDAADVQRHPFFRHINWDDLLARRVDPPFRPSLQSEEDVSQFDA
RFTRQTPVDSPDDTTLSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRT
PISPLKFSPFEGFRPSPGPPEPMEPSLPPLLPPPSSPPPTSTAPLPIRPPSGTKKSKKGR
GRPRR
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggccgtgtttgatttagacttggagaccgaggaagggagcgagggcgagggcgaa
ccggagttcagccctgcggacgtgtgtccccttggcgagttaagggctgctggcctggag
acagtgggacactatgaagaagtggagctgacagagagcagcgtgaacctgggtcctgag
cgcatcgggccccactgctttgagctactgagtgtactgggcaaggggggctatggcaag
gtgttccaggtgagaaaagtgcaaggcaccaacttgggaaaaatatatgccatgaaggtc
ttgaggaaggccaagattgtatgcagtgccaaggacacagcccatacccgggctgagagg
aacattctagaatctgtgaagcatcccttcattgtagaactggcctatgctttccagaca
ggtggcaaactctacctcatcctggagtgcctcagtggtggtgagctcttcacacatctt
gagcgagaaggcatcttcctggaagacacagcctgcttctacctgggagagatcacacta
gccctgggccatctccattcccacggcatcatctaccgggacctcaagcctgagaacatc
atgctcaacagccagggccacatcaaattgacagactttgggctctgcaaggagtccatt
catgagggcgccatcactcacaccttctgcggcaccattgagtacatggccccagagatt
ctagtgcgcactggtcacaaccgggcagtggactggtggagcctgggagccctgatgtat
gacatgctcactggatcgccgcccttcaccgcagagaaccggaagaaaactatggataaa
atcattaaagggaagctggtgctgcccccctacctcaccccggatgcccgggaccttgcc
aaaaagtttctgaagcggaatcccattcagcgaatcgggggtggcccaggagatgctgct
gatgtacagaggcacccttttttccggcacatcaattgggatgacctcttggcccgccgc
gtggaccctcccttcagaccgagtctgcaatcagaagaggatgtgagccagtttgatgca
cgattcacacggcagacgccagtagatagtccagatgacacaaccctcagtgagagtgcc
aaccaagccttcctgggattcacgtatgtggcaccttctgtcctggacagcatcaaagag
ggcttctccttccagcccaagctgcgttcccccagacgccttaacagcagtccccgcacc
cccatcagccccctcaagttctctccctttgaggggttccggcccagtcctggcccgcca
gagcccatggagccatctctacctccactcctgccaccaccatcatcaccaccacccaca
agcactgccccccttcccatccgtcccccctcaggaaccaagaagtccaagaagggacgg
ggccgcccacggcgttag

KEGG   Mus pahari (shrew mouse): 110331448
Entry
110331448         CDS       T05929                                 

Gene name
Rps6kb1
Definition
(RefSeq) ribosomal protein S6 kinase beta-1 isoform X1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04350  TGF-beta signaling pathway
mpah04371  Apelin signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04931  Insulin resistance
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110331448 (Rps6kb1)
   04350 TGF-beta signaling pathway
    110331448 (Rps6kb1)
   04371 Apelin signaling pathway
    110331448 (Rps6kb1)
   04066 HIF-1 signaling pathway
    110331448 (Rps6kb1)
   04151 PI3K-Akt signaling pathway
    110331448 (Rps6kb1)
   04152 AMPK signaling pathway
    110331448 (Rps6kb1)
   04150 mTOR signaling pathway
    110331448 (Rps6kb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110331448 (Rps6kb1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    110331448 (Rps6kb1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110331448 (Rps6kb1)
  09149 Aging
   04211 Longevity regulating pathway
    110331448 (Rps6kb1)
   04213 Longevity regulating pathway - multiple species
    110331448 (Rps6kb1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110331448 (Rps6kb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331448 (Rps6kb1)
   05205 Proteoglycans in cancer
    110331448 (Rps6kb1)
   05231 Choline metabolism in cancer
    110331448 (Rps6kb1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110331448 (Rps6kb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110331448 (Rps6kb1)
   05212 Pancreatic cancer
    110331448 (Rps6kb1)
   05225 Hepatocellular carcinoma
    110331448 (Rps6kb1)
   05226 Gastric cancer
    110331448 (Rps6kb1)
   05221 Acute myeloid leukemia
    110331448 (Rps6kb1)
   05224 Breast cancer
    110331448 (Rps6kb1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110331448 (Rps6kb1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110331448 (Rps6kb1)
   05163 Human cytomegalovirus infection
    110331448 (Rps6kb1)
   05165 Human papillomavirus infection
    110331448 (Rps6kb1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110331448 (Rps6kb1)
   01522 Endocrine resistance
    110331448 (Rps6kb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331448 (Rps6kb1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110331448 (Rps6kb1)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   110331448 (Rps6kb1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 110331448
NCBI-ProteinID: XP_021067711
Ensembl: MGP_PahariEiJ_G0018045
LinkDB
Position
14
AA seq 525 aa
MRRRRRRDGFYPAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAEXNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC
KESIHDGTXTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK
TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL
LARKVEPPFKPLLQSEEDVSQFDSKFTCQPPVDSPDDSTLSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIXSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacgacggaggcgggacggcttttacccagcgcctgacttccgacacagggaa
gctgaggacatggcaggcgtgtttgacatagacctggaccagccagaggatgcaggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaagatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaggacacagcccataca
aaagcagagnggaatattctggaggaagtaaaacaccctttcattgtggacttaatttat
gcctttcagaccggtgggaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatattcatggaagacacagcgtgcttttacttggct
gaaatctccatggctttggggcatttacatcaaaaagggatcatctacagagatctgaag
ccggagaacatcatgcttaatcatcaaggtcatgtgaaactaacagactttggactatgc
aaagaatctattcatgatggaacagncacacacacattttgtggaacaatagaatacatg
gcccctgaaatcttaatgagaagcggccacaaccgtgctgtggattggtggagtttggga
gcattaatgtatgacatgctgactggagcacctccatttactggggagaatagaaagaaa
acaattgacaaaatcctcaaatgtaaacttaatttgcctccctacctcacacaagaagct
cgagatctgcttaaaaagctgctgaaaagaaatgctgcttctcgtcttggagctggccct
ggggatgctggagaagtccaagctcatccatttttcagacacattaactgggaagaactt
ctggctcggaaggtggaacctccctttaagcctctgttgcaatctgaagaggatgtgagt
cagtttgattcaaagtttacatgtcagccacctgttgacagccctgatgactccactctc
agtgaaagtgccaaccaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcttttgaaccaaaaatcngatctcctagaagatttattggt
agcccacgaacgcctgtcagcccagtcaagttctctcctggggatttctggggacgaggt
gcttcagccagcacggcaaatcctcagacccccgtggaatacccaatggaaacaagtggg
atagagcagatggatgtgacagtgagcggggaagcatcagcgccacttccaatccgacaa
cccaactccgggccntacaaaaaacaagcttttcctatgatctccaaacggccagagcac
ctgcggatgaatctatga

DBGET integrated database retrieval system