KEGG   Mus pahari (shrew mouse): 110316047
Entry
110316047         CDS       T05929                                 

Gene name
Rassf4
Definition
(RefSeq) ras association domain-containing protein 4
  KO
K09851  Ras association domain-containing protein 2/4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110316047 (Rassf4)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2 DUF5494
Other DBs
NCBI-GeneID: 110316047
NCBI-ProteinID: XP_021045790
Ensembl: MGP_PahariEiJ_G0022528
LinkDB
Position
2
AA seq 322 aa
MKEACSSSSHVPISDSKSILKSELLSLLKTYNCYHEGRSFQLRHREEEGTLIIEGLLNIA
WGLRRPIRLQMQDDRERVQLPSANWVPERLSYLQKEASPQDSKVPAEEPSAQPANKAEVS
GDSSGPLEGEEEEVPQLMRTKSDASCIIQRRSKSRAPSEAQKIRRHRFSINGHFYNHKTS
VFTPAYGSVTNVRVNSTMTTQQVLTLLLNKFRVEDGPSEFALYTVHESGEQTKLKDCEYP
LISRILHGPCEKIVKIFLMEADLSEEVPHDVAQYIKFEMPVLDSFVEKLKEEEEREIIKL
TMKFQALRLTMLQRLEQLVEAK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaaggaagcttgctcttccagctctcatgtgcctatcagcgacagcaagtccattctg
aagtcagaactcttaagcctgctcaaaacctacaactgctaccatgagggcaggagcttc
cagctaagacaccgagaggaagaggggactctgatcatcgaaggactcctcaacattgcc
tggggactcagacgacccatccggctgcagatgcaggatgatcgggagcgagtgcaactg
ccatctgccaactgggtgcctgagaggctcagctacctccaaaaggaagcttcaccccag
gacagcaaggtccctgctgaagagcctagcgctcaacctgccaacaaggcagaggtttcc
ggagatagctcaggacccctggagggggaagaggaggaggtgccacagcttatgcggaca
aagagcgatgccagctgcataatccagaggaggtccaaatcccgggcaccgagcgaagcc
cagaagatacgacggcaccggttctccatcaatggacacttttataaccacaagacctcc
gtgttcactcctgcctatgggtctgtgaccaacgtccgggttaacagcactatgaccacc
cagcaggtgctcaccctgctgctaaacaagttccgggtagaagatggtcccagtgagttc
gcactctacaccgtccatgagtctggggagcagacaaaattaaaagattgcgagtatccg
ctgatatccagaatcctgcatgggccctgtgaaaaaattgtcaagatcttcttgatggaa
gctgacttgagcgaggaggtgccccatgatgttgcccagtacattaagtttgaaatgccg
gtgctggacagttttgttgaaaaattaaaagaagaggaagaaagagaaataatcaaactg
accatgaagttccaagccctgcgtctaacaatgctgcagcgtctggaacagctagtggag
gccaagtag

KEGG   Mus pahari (shrew mouse): 110318972
Entry
110318972         CDS       T05929                                 

Gene name
Rassf2
Definition
(RefSeq) ras association domain-containing protein 2
  KO
K09851  Ras association domain-containing protein 2/4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110318972 (Rassf2)
SSDB
Motif
Pfam: Nore1-SARAH RA DUF4125 Ras_bdg_2
Other DBs
NCBI-GeneID: 110318972
NCBI-ProteinID: XP_021049997
Ensembl: MGP_PahariEiJ_G0025780
LinkDB
Position
3
AA seq 326 aa
MDYTHPPALIPCGQDKYMPKSELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDHERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPTVQISEVDVPVESPE
THSPTDSRGLKPVQEDTPQLMRTRSDVGVRRRGNVRTSSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKNSDY
PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVEK
LMRKYTVLRLMIRQRLEEIAETPETI
NT seq 981 nt   +upstreamnt  +downstreamnt
atggactacactcacccacctgccctaatcccatgtggacaagacaagtacatgcccaag
agtgagcttctcctacatctgaagacctacaacttgtactatgaaggccaaaacctgcaa
ctccgacaccgagaggaggaagacgagttcattgtggaggggttactgaacatttcctgg
gggctgcgcaggcccattcggctgcagatgcaggatgaccacgaacgcatccgcccccct
ccatcctcctcctcctggcactccggctgcaacctgggcgcacagggcaccacactgaag
cccctcaccgtgcccactgttcagatctcagaagtggatgtgccagttgaaagcccggag
acacacagcccaacagattccagaggcctgaagcctgtgcaggaggacaccccacagttg
atgcgcacacgcagcgatgttggggtgcgtcgccgtggcaacgtgaggacatccagtgac
cagagacgaatcagacgccatcgtttctccatcaatggccatttctataaccataagaca
tcagtgttcacaccagcctacggctctgtcaccaatgtccgtatcaacagcaccatgacc
actccgcaggtcctgaagttgctgctcaacaagtttaagattgagaactcggcagaggag
tttgcactgtacgtggtccacaccagcggtgaaaagcagaagctgaagaactccgactac
cctctgatcgcccgcatcctccagggcccgtgtgaacagatctccaaagttttcctgatg
gagaaggaccaggtggaggaagtcacctacgacgtggcccagtatataaagttcgagatg
ccagtccttaaaagcttcattcagaaactccaggaggaggaagaccgggaggtggagaag
ctgatgcgaaagtacaccgtgctccggctaatgattcggcaaaggcttgaggagatagca
gagacccctgagactatctga

DBGET integrated database retrieval system