KEGG   Mus pahari (shrew mouse): 110316221
Entry
110316221         CDS       T05929                                 

Gene name
Kras
Definition
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04068  FoxO signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04371  Apelin signaling pathway
mpah04540  Gap junction
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04625  C-type lectin receptor signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04714  Thermogenesis
mpah04720  Long-term potentiation
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04730  Long-term depression
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04912  GnRH signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04916  Melanogenesis
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05034  Alcoholism
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316221 (Kras)
   04012 ErbB signaling pathway
    110316221 (Kras)
   04014 Ras signaling pathway
    110316221 (Kras)
   04015 Rap1 signaling pathway
    110316221 (Kras)
   04370 VEGF signaling pathway
    110316221 (Kras)
   04371 Apelin signaling pathway
    110316221 (Kras)
   04068 FoxO signaling pathway
    110316221 (Kras)
   04072 Phospholipase D signaling pathway
    110316221 (Kras)
   04071 Sphingolipid signaling pathway
    110316221 (Kras)
   04151 PI3K-Akt signaling pathway
    110316221 (Kras)
   04150 mTOR signaling pathway
    110316221 (Kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110316221 (Kras)
   04137 Mitophagy - animal
    110316221 (Kras)
  09143 Cell growth and death
   04210 Apoptosis
    110316221 (Kras)
   04218 Cellular senescence
    110316221 (Kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    110316221 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    110316221 (Kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110316221 (Kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110316221 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    110316221 (Kras)
   04660 T cell receptor signaling pathway
    110316221 (Kras)
   04662 B cell receptor signaling pathway
    110316221 (Kras)
   04664 Fc epsilon RI signaling pathway
    110316221 (Kras)
   04062 Chemokine signaling pathway
    110316221 (Kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110316221 (Kras)
   04929 GnRH secretion
    110316221 (Kras)
   04912 GnRH signaling pathway
    110316221 (Kras)
   04915 Estrogen signaling pathway
    110316221 (Kras)
   04914 Progesterone-mediated oocyte maturation
    110316221 (Kras)
   04917 Prolactin signaling pathway
    110316221 (Kras)
   04921 Oxytocin signaling pathway
    110316221 (Kras)
   04926 Relaxin signaling pathway
    110316221 (Kras)
   04935 Growth hormone synthesis, secretion and action
    110316221 (Kras)
   04919 Thyroid hormone signaling pathway
    110316221 (Kras)
   04916 Melanogenesis
    110316221 (Kras)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110316221 (Kras)
  09156 Nervous system
   04725 Cholinergic synapse
    110316221 (Kras)
   04726 Serotonergic synapse
    110316221 (Kras)
   04720 Long-term potentiation
    110316221 (Kras)
   04730 Long-term depression
    110316221 (Kras)
   04722 Neurotrophin signaling pathway
    110316221 (Kras)
  09158 Development and regeneration
   04360 Axon guidance
    110316221 (Kras)
  09149 Aging
   04211 Longevity regulating pathway
    110316221 (Kras)
   04213 Longevity regulating pathway - multiple species
    110316221 (Kras)
  09159 Environmental adaptation
   04714 Thermogenesis
    110316221 (Kras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316221 (Kras)
   05206 MicroRNAs in cancer
    110316221 (Kras)
   05205 Proteoglycans in cancer
    110316221 (Kras)
   05203 Viral carcinogenesis
    110316221 (Kras)
   05230 Central carbon metabolism in cancer
    110316221 (Kras)
   05231 Choline metabolism in cancer
    110316221 (Kras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110316221 (Kras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110316221 (Kras)
   05212 Pancreatic cancer
    110316221 (Kras)
   05225 Hepatocellular carcinoma
    110316221 (Kras)
   05226 Gastric cancer
    110316221 (Kras)
   05214 Glioma
    110316221 (Kras)
   05216 Thyroid cancer
    110316221 (Kras)
   05221 Acute myeloid leukemia
    110316221 (Kras)
   05220 Chronic myeloid leukemia
    110316221 (Kras)
   05218 Melanoma
    110316221 (Kras)
   05211 Renal cell carcinoma
    110316221 (Kras)
   05219 Bladder cancer
    110316221 (Kras)
   05215 Prostate cancer
    110316221 (Kras)
   05213 Endometrial cancer
    110316221 (Kras)
   05224 Breast cancer
    110316221 (Kras)
   05223 Non-small cell lung cancer
    110316221 (Kras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316221 (Kras)
   05022 Pathways of neurodegeneration - multiple diseases
    110316221 (Kras)
  09165 Substance dependence
   05034 Alcoholism
    110316221 (Kras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110316221 (Kras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110316221 (Kras)
   05170 Human immunodeficiency virus 1 infection
    110316221 (Kras)
   05161 Hepatitis B
    110316221 (Kras)
   05160 Hepatitis C
    110316221 (Kras)
   05163 Human cytomegalovirus infection
    110316221 (Kras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110316221 (Kras)
   05165 Human papillomavirus infection
    110316221 (Kras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316221 (Kras)
   01522 Endocrine resistance
    110316221 (Kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110316221 (Kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mpah04031]
    110316221 (Kras)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    110316221 (Kras)
GTP-binding proteins [BR:mpah04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    110316221 (Kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 NPR1_interact G-alpha FeoB_N ATP_bind_1 CbiA
Other DBs
NCBI-GeneID: 110316221
NCBI-ProteinID: XP_021045989
Ensembl: MGP_PahariEiJ_G0022808
LinkDB
Position
2
AA seq 227 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCVIMGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSRTRCIVM
NT seq 684 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgagaactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaggactctgaagatgtgcctatggtcctggtagggaataagtgtgatttg
ccttctagaacagtagacacgaaacaggctcaggagttagcaaggagttacgggattccg
ttcattgagacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcgttataatgggtgttgacgatgccttctatacattagtccga
gaaattcgaaaacataaagaaaagatgagcaaagatgggaaaaagaagaagaagaagtca
aggacaaggtgtatagttatgtga

DBGET integrated database retrieval system