KEGG   Mus pahari (shrew mouse): 110316560
Entry
110316560         CDS       T05929                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04151  PI3K-Akt signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah05162  Measles
mpah05165  Human papillomavirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05206  MicroRNAs in cancer
mpah05215  Prostate cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110316560 (Cdkn1b)
   04066 HIF-1 signaling pathway
    110316560 (Cdkn1b)
   04068 FoxO signaling pathway
    110316560 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    110316560 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110316560 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316560 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    110316560 (Cdkn1b)
   05206 MicroRNAs in cancer
    110316560 (Cdkn1b)
   05203 Viral carcinogenesis
    110316560 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    110316560 (Cdkn1b)
   05220 Chronic myeloid leukemia
    110316560 (Cdkn1b)
   05215 Prostate cancer
    110316560 (Cdkn1b)
   05222 Small cell lung cancer
    110316560 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110316560 (Cdkn1b)
   04934 Cushing syndrome
    110316560 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    110316560 (Cdkn1b)
   05169 Epstein-Barr virus infection
    110316560 (Cdkn1b)
   05165 Human papillomavirus infection
    110316560 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110316560 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110316560
NCBI-ProteinID: XP_021046600
Ensembl: MGP_PahariEiJ_G0022746
LinkDB
Position
2
AA seq 197 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVLAQESQDVSGSRQAVPLIG
AQANSEDRHLVDQMPDSSDNPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSRN
AGSVEQTPKKPGLRRQT
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgagagtgtctaacgggagcccgagcctggagcggatggacgccagacaa
gcggagcaccccaagccttccgcctgcagaaacctcttcggcccggtcaatcatgaagaa
ctaacccgggacttggagaagcactgccgagatatggaagaagcgagtcagcgcaagtgg
aatttcgactttcagaatcataagcccctggagggcagatacgagtggcaggaggtggag
agaggcagcttgcccgagttctactacaggcccccgcgcccccccaagagcgcctgcaag
gtgctggcgcaggagagccaggatgtcagcgggagccgccaggcggtgcctttaattggg
gctcaggcaaactctgaggaccggcatttggtggaccaaatgcccgactcgtcagataat
ccggctgggttagcggagcagtgtccagggatgaggaagcgacctgctgcagaagattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttcccggaac
gctggctctgtggagcagacgcccaagaagcccggccttcgacgccagacgtaa

DBGET integrated database retrieval system