KEGG   Mus pahari (shrew mouse): 110316577
Entry
110316577         CDS       T05929                                 

Gene name
Tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04915  Estrogen signaling pathway
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05223  Non-small cell lung cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316577 (Tgfa)
   04012 ErbB signaling pathway
    110316577 (Tgfa)
   04014 Ras signaling pathway
    110316577 (Tgfa)
   04151 PI3K-Akt signaling pathway
    110316577 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110316577 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316577 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110316577 (Tgfa)
   05212 Pancreatic cancer
    110316577 (Tgfa)
   05225 Hepatocellular carcinoma
    110316577 (Tgfa)
   05214 Glioma
    110316577 (Tgfa)
   05211 Renal cell carcinoma
    110316577 (Tgfa)
   05215 Prostate cancer
    110316577 (Tgfa)
   05223 Non-small cell lung cancer
    110316577 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316577 (Tgfa)
SSDB
Motif
Pfam: EGF TMEM154
Other DBs
NCBI-GeneID: 110316577
NCBI-ProteinID: XP_021046631
Ensembl: MGP_PahariEiJ_G0022328
LinkDB
Position
2
AA seq 159 aa
MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcgaccggacagctcgctctgctagcgctgggtatcctgttagccgtgtgc
caggctctggagaacagtacgtcccccctgagtgactcacccgtggcggctgcagtggtg
tctcacttcaacaagtgcccagattcccacactcagtactgcttccatggaacctgcagg
tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc
tgtgagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcacc
gccctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc
cactgctgtcagctccgcaagcactgcgagtggtgccgtgcccttgtctgcagacacgag
aaacccagcgccctcctgaagggaaggactgcttgctgccattctgagacagtggtctga

DBGET integrated database retrieval system