KEGG   Mus pahari (shrew mouse): 110316808
Entry
110316808         CDS       T05929                                 

Gene name
Jak2
Definition
(RefSeq) tyrosine-protein kinase JAK2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04062  Chemokine signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04725  Cholinergic synapse
mpah04917  Prolactin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05164  Influenza A
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05200  Pathways in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110316808 (Jak2)
   04151 PI3K-Akt signaling pathway
    110316808 (Jak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110316808 (Jak2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110316808 (Jak2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110316808 (Jak2)
   04659 Th17 cell differentiation
    110316808 (Jak2)
   04062 Chemokine signaling pathway
    110316808 (Jak2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110316808 (Jak2)
   04917 Prolactin signaling pathway
    110316808 (Jak2)
   04935 Growth hormone synthesis, secretion and action
    110316808 (Jak2)
  09156 Nervous system
   04725 Cholinergic synapse
    110316808 (Jak2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316808 (Jak2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110316808 (Jak2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110316808 (Jak2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110316808 (Jak2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110316808 (Jak2)
   05164 Influenza A
    110316808 (Jak2)
   05168 Herpes simplex virus 1 infection
    110316808 (Jak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110316808 (Jak2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110316808 (Jak2)
   05140 Leishmaniasis
    110316808 (Jak2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110316808 (Jak2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110316808 (Jak2)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110316808 (Jak2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 110316808
NCBI-ProteinID: XP_021046875
Ensembl: MGP_PahariEiJ_G0014347
LinkDB
Position
1
AA seq 1132 aa
MGMACLTMTEMEATSTSPVHQNGDIPGNANSVKQIDPVLQVYLYHSLGQAEGEYLKFPSG
EYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHTILYRIRFYF
PHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLK
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGDYNLSGTKRNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDAQISPTLQRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWA
MHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLGALDSQRKLQFYEDKHQLPAPKWTEL
ANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSMAA
NT seq 3399 nt   +upstreamnt  +downstreamnt
atgggaatggcttgtcttacaatgacagaaatggaggcaacctccacatctcctgtacat
cagaatggtgatattcctggaaatgctaattctgtgaagcagatagatccagtccttcaa
gtgtatctgtaccattctcttgggcaagctgaaggagagtatctgaagtttccaagtgga
gagtatgttgcagaagaaatttgtgtggctgcttctaaagcttgtggtattacgcctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaatcat
gtcttccacatagatgagtcaaccaggcatacaatactctacagaataaggttctacttc
cctcattggtactgcagtggcagcagcagaacctacagatacggagtatctcgtggggct
gaagctcctcttcttgacgactttgtcatgtcttacctttttgctcagtggcggcatgat
tttgttcatggatggataaaagtgcccgtgactcatgaaactcaggaagaatgtcttggg
atggcagtgttagacatgatgagaatagctaaggagaaggaccagactccactggctgtc
tataactctgtcagctacaagacattcttaccaaagtgcattcgagcgaagatccaagac
tatcacattttaacccgaaagcgaataaggtacagatttcgcagattcattcagcaattc
agtcaatgtaaagccactgccaggaacctaaaacttaagtatcttataaacctggaaacc
ctgcagtctgccttctacacagaacagtttgaagtaaaagaatctgcaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaggaaagtgagacactgacagaacaggatttacagttatattgtgatttt
cctgatattattgatgtcagtattaagcaagcaaaccaggaatgctcaaatgaaagtaga
attgtaactgtccataaacaagatggtaaagttttggaaatagaacttagctcattaaaa
gaagccctgtcattcgtgtcattaattgatgggtattacagactaactgcggatgcgcac
cattacctctgtaaagaggtggctcctccagctgtgctcgagaacatacacagcaactgc
catggcccaatatcaatggattttgccattagcaaactaaagaaggcgggtaaccagact
ggactgtatgtgcttcgatgtagccctaaggacttcaacaaatactttctgacctttgct
gttgagcgagaaaatgtcattgaatataaacactgtttgattacgaagaatgagaatgga
gactacaacctcagtgggactaagaggaacttcagtaatcttaaggaccttttgaattgc
taccagatggaaactgtgcgctcagacagtatcatcttccagtttaccaaatgctgtccc
ccaaagccaaaagataaatcaaatcttctcgtcttcagaacaaatggtatttctgatgct
cagatctcaccaacattacagaggcataataatgtgaatcaaatggtgtttcacaaaatc
aggaatgaagatttgatatttaatgaaagtcttggccaaggcacttttacaaaaattttt
aaaggtgtaagaagagaagttggagattacggtcagctgcacgaaacggaagttctgttg
aaagtcctggataaagcacacaggaactactcagagtctttctttgaagcagcaagcatg
atgagccagctttctcacaagcacttggttttgaattatggagtatgtgtctgcggagag
gagaacattctggttcaagagtttgtaaaatttggatcactggatacatacctgaaaaaa
aacaaaaattccataaatatattatggaaacttggagtggctaagcagttggcatgggcc
atgcattttctagaagaaaaatcccttattcatgggaatgtgtgtgccaaaaacatcctg
cttatcagagaagaagacaggagaacggggaatccacctttcatcaaacttagtgatcct
ggcattagcattacagttctaccgaaggacattcttcaggagagaataccatgggtaccg
cctgaatgcattgagaatcctaaaaatctaaatctggcaacagacaagtggagcttcggg
accactctgtgggagatctgcagtggaggagataagcccctgggtgctctggattctcaa
agaaagctgcagttctatgaagataagcaccagcttcctgcacccaagtggacagaatta
gcaaaccttataaataattgcatggactatgagccagatttcaggcccgctttcagagct
gtcatccgtgatcttaacagcctgtttactccagattatgaactgctaacagaaaacgac
atgctacccaacatgagaataggagctctaggattttctggtgcttttgaagacagggac
cctacacagtttgaagagaggcacttgaagtttctacagcagcttggcaagggtaacttt
gggagtgtggagatgtgccgctatgacccgctgcaggacaacactggagaggtggtggct
gtgaagaagctccagcacagcacggaagagcacctccgagactttgaacgggaaatcgaa
atcctgaagtccttgcagcatgacaacattgtgaagtacaagggcgtgtgctacagtgcg
ggtcggcgcaacctaagattaattatggaatatttgccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcacaaaaaacttctgcagtatacatctcagata
tgcaagggcatggaatatcttggtacaaaaaggtatatccacagggacctggcaacaagg
aacatattggtggaaaatgagaacagggttaaaataggagactttggattaaccaaagtc
ttgccgcaggacaaagagtactacaaagtaaaggagccaggggaaagccccatattctgg
tatgcacctgaatccttgacggagagcaagttttctgtggcctcagatgtgtggagcttt
ggagtggttctatatgaacttttcacatacatcgagaagagtaaaagtccacccgtggaa
tttatgcgaatgattggcaatgataaacaagggcaaatgattgtgttccatttgatagag
ctactgaagaataacgggagattgccaaggccagaaggatgcccagatgagatttatgtg
atcatgacagagtgctggaacaacaatgtaagccaacgtccctctttcagggacctttcc
cttcgggtggatcaaatccgggacagtatggctgcatga

KEGG   Mus pahari (shrew mouse): 110322912
Entry
110322912         CDS       T05929                                 

Gene name
Jak1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05140  Leishmaniasis
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05212  Pancreatic cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110322912 (Jak1)
   04151 PI3K-Akt signaling pathway
    110322912 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110322912 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110322912 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110322912 (Jak1)
   04658 Th1 and Th2 cell differentiation
    110322912 (Jak1)
   04659 Th17 cell differentiation
    110322912 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110322912 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322912 (Jak1)
   05203 Viral carcinogenesis
    110322912 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322912 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110322912 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110322912 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322912 (Jak1)
   05161 Hepatitis B
    110322912 (Jak1)
   05160 Hepatitis C
    110322912 (Jak1)
   05171 Coronavirus disease - COVID-19
    110322912 (Jak1)
   05164 Influenza A
    110322912 (Jak1)
   05162 Measles
    110322912 (Jak1)
   05168 Herpes simplex virus 1 infection
    110322912 (Jak1)
   05163 Human cytomegalovirus infection
    110322912 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322912 (Jak1)
   05169 Epstein-Barr virus infection
    110322912 (Jak1)
   05165 Human papillomavirus infection
    110322912 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110322912 (Jak1)
   05140 Leishmaniasis
    110322912 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110322912 (Jak1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110322912 (Jak1)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110322912 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 110322912
NCBI-ProteinID: XP_021055510
Ensembl: MGP_PahariEiJ_G0028540
LinkDB
Position
6
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKRVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELS
RCHSNDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLEYNKHKKDDERNKLR
EEWNNFSYFPEITHIVIKESVVSINKQDNKNMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSMDHFPSLRDLMNHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGT
LLDYKDDEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRRSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSDIGPFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERQPTTEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICMEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
FSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggcgttctgtgctaaaatgagg
agcttcaagaagactgaggtgaagcaggtggtccctgagccaggagtggaggtgactttc
tatctgttggacagggagcccctccgcctgggcagcggagagtatacagccgaggagctg
tgcatcagggccgcccaggagtgcagtatctctcctctctgtcacaacctcttcgccctg
tacgatgagagcaccaagctctggtatgctccgaaccgaatcatcactgtggatgacaaa
atgtctctccggctccactaccgcatgaggttctattttaccaactggcacggaaccaat
gacaatgaacagtccgtatggcgacattctccaaagaagcagaaaaacggctatgagaag
aaaagggttccagaagcaaccccactcctcgatgccagttcactggagtatctgtttgca
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacagagcaa
gacggacatgatattgagaatgagtgcctgggcatggcggtcctggccatctcccactat
gccatgatgaagaagatgcagttgccggaacttcccaaagacatcagctacaagcgatat
attccagaaacattgaataaatccatcagacagaggaaccttcttaccaggatgcgaata
aataatgttttcaaggatttcttgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtctacacatgatctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggagctgaaatatttgagacttctatgctactgatttcatcagaaaatgaattgagt
cggtgccattcgaatgacagtggcaatgttctctatgaagtcatggtgactggaaatctt
gggatccagtggcggcagaaaccaaacgttgttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggaatataataaacacaagaaggacgatgagagaaacaaactccgg
gaagagtggaacaatttttcctatttccctgaaatcacccacattgtaataaaggagtct
gtggtcagcattaacaaacaggacaacaaaaacatggaactcaagctctcttctcatgaa
gaagccttgtcctttgtgtccctggtggatggctacttccgtctcactgcggatgcccac
cattacctctgtactgatgtggctcccccactgattgtccacaatatacagaacggctgt
cacggtccaatctgcacagaatatgccatcaataagctgcgtcaagaagggagtgaagag
ggaatgtacgtgctgaggtggagctgcactgactttgacaacattcttatgactgtcacc
tgctttgaaaagtctgaggtattgggtggccagaagcagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctctatggaccactttcccagcctgcgagac
ctcatgaaccacctcaagaagcagatcctgcgcacggacaacataagctttgtgctgaaa
cgctgctgtcagcctaagccccgagaaatctccaatctgcttgtagccactaagaaggcc
caggagtggcagcctgtctactccatgagccagctgagttttgatcggatccttaagaaa
gatattatacaaggtgagcaccttggcagaggcacaagaacacatatctattctgggacc
ctgctggactacaaggatgatgaaggaattgctgaagagaagaagataaaagtgatcctc
aaagtcctagaccccagccaccgggacatttctctggccttctttgaggcagctagcatg
atgagacaggtttcccataaacacattgtgtacctctatggcgtctgtgtccgagatgtg
gagaatatcatggtggaagagtttgtggagggggggccgttggatctcttcatgcaccgg
agaagtgatgcgcttactaccccctggaagttcaaggttgccaaacagctggccagtgcc
ctgagttacttggaagataaagacctggttcatggaaatgtgtgcactaaaaacctcctt
ctggcccgtgagggcattgacagtgacattggcccgtttatcaagcttagtgaccctggc
atcccagtctctgtgctgaccaggcaagagtgcatagagcgaatcccctggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggctgctgacaagtggagctttggaacc
acactctgggaaatctgctacaatggagagatccccctcaaagacaagaccctcattgag
aaagagaggttttatgaaagccgctgcaggcctgtgactccatcttgcaaggagctagct
gacctcatgactcgctgcatgaactatgatcccaaccagagacccttcttccgagccatc
atgagggatattaacaagctggaggagcagaatccagacattgtttcagaaaggcagcca
acaacagaggtggaccccactcattttgaaaagcgtttcctgaagaggattcgtgacttg
ggagagggtcactttgggaaggttgagctctgcagatatgatcccgagggagacaacaca
ggggaacaggtagctgtcaagtccctgaagcctgagagtggaggcaaccacatagctgat
ctgaagaaggagatagagatcttacggaacctctaccatgagaacattgtgaagtacaaa
ggaatctgcatggaagatggagggaatggtatcaagctcatcatggagtttctgccttcg
ggaagcctaaaggagtatctgccgaagaataagaacaaaatcaacctcaaacagcagcta
aaatacgccattcagatttgtaaggggatggactatttgggttctcggcaatacgttcac
cgggacttagcagcaagaaatgtccttgttgagagtgagcatcaagtaaagatcggagac
tttggtttaaccaaagcgattgaaaccgataaggagtactacacagtcaaggatgaccgg
gacagcccagtgttctggtacgctccggaatgtttgatccagtgtaaattttatatcgcc
tctgacgtctggtcttttggagtgacactgcatgagctgctcacttactgtgattcagac
tttagtcccatggccttgttcctgaaaatgataggaccaactcatggccagatgacagta
actcggcttgtgaatactctgaaagaagggaagcgtctgccatgtccacccaactgtcct
gatgaggtttatcagcttatgagaaaatgctgggaattccaaccatctaaccggacaacc
tttcagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Mus pahari (shrew mouse): 110327406
Entry
110327406         CDS       T05929                                 

Gene name
Tyk2
Definition
(RefSeq) non-receptor tyrosine-protein kinase TYK2 isoform X1
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04217  Necroptosis
mpah04380  Osteoclast differentiation
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05145  Toxoplasmosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110327406 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110327406 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110327406 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    110327406 (Tyk2)
   04659 Th17 cell differentiation
    110327406 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110327406 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    110327406 (Tyk2)
   05160 Hepatitis C
    110327406 (Tyk2)
   05171 Coronavirus disease - COVID-19
    110327406 (Tyk2)
   05164 Influenza A
    110327406 (Tyk2)
   05162 Measles
    110327406 (Tyk2)
   05168 Herpes simplex virus 1 infection
    110327406 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110327406 (Tyk2)
   05169 Epstein-Barr virus infection
    110327406 (Tyk2)
   05165 Human papillomavirus infection
    110327406 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110327406 (Tyk2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110327406 (Tyk2)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110327406 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 110327406
NCBI-ProteinID: XP_021062030
Ensembl: MGP_PahariEiJ_G0014727
LinkDB
Position
10
AA seq 1208 aa
MVGSMPLCGRRATLKDSKADGTDFQPLVPTGRLMVLLHWPGPKGGEPWVTFSQTSLTAEE
VCIHIAHKVGITPPCLNLFALYNAQANVWLPPNHILDASQDVSLYFRVRFYFRNWHGMHP
QEPAVYRCGFPGAENSSDRAEQGVQLLDSASFEYLFEQVWFVGNRAKSSHTSFSIHPSSP
QGKHDFMNDVVSLRDLSSEEEIHHFKNESLGMAFLHLCHLALSRGVPLEEMAREISFENC
IPHSFRQHIRQHNVLTRLRLRRVFRRFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSER
IPVCHLEVLAQPERDPCYIQNSGQTTGDPGPELPSGPPTHEVLVTGTGGIQWHPLQTQES
ERSNSRENPQGSSRSGKKPKGPEAGERLAESPQEPPWTYFCDFQDISHVVLKERRVHIHL
QDNKCLLLCLCSQAEALSFVALVDGYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMD
PFVQAKLWPEDGLYLIQWSTSHLHRLILTVAHRNPAPGNGPRGLRLRKFPITQQPGAFVL
DGWGRSFDSLGDLRLALQGCSLRAGDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNL
SQLSFHRVHQDEITQLSHLGQGTRTNVYEGLLRVGGPDEGKVDNGCPREPVGASGQQLRV
VLKVLDPSHHDIALAFYETASLMSQVSHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWL
RRQRGQVPMTWKMAVAQQLASALSYLEDKNLVHGNVCGRNILLARLGLEEGTSPFIKLSD
PGVGQGALSREERVERIPWTAPECLSGGTSSLGTATDMWGFGATLLEICFDGEAPLQGRG
PSEKERFYTKKHQLPEPSCPELATLTRQCLTYEPAQRPSFRTILRDLTRLQPQNLVGISA
VNSDSPASDPTVFHKRYLKKIRDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQ
LRSGWQREIEILRTLYHEHIVKYKGCCEDQGEKSVQLVMEYVPLGSLRDYLPRHSVGLAQ
LLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVRE
DGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTYCDSNQSPHTKFTELIGHTQGQM
TVLRLTELLERGERLPRPDRCPCEIYHLMKSCWETEASFRPTFQNLVPILKTAQEKYQGR
VPSVFSVC
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggtggggagcatgcctctgtgtgggcggagagccaccttgaaagacagcaaggcagat
ggcacagattttcagcccctggtgcccacaggacgcttgatggtgctgctgcactggcct
ggacctaagggtggggagccctgggtcaccttcagccagacatctctgactgcagaggag
gtctgcatccacatcgcacacaaagtcggcatcactccaccctgcttgaatctcttcgca
ctctacaatgcacaggccaacgtctggctgcccccaaaccatattctggatgcatcccaa
gatgtgagcctctattttcgagtgaggttttacttccggaactggcacggcatgcatccc
caggagccagctgtataccgatgtggtttcccaggggcagagaattcctctgaccgggca
gaacaaggtgtacagctcttggactctgcctcatttgaatacctttttgagcaggtgtgg
tttgttggcaatagagcaaaaagctcccacacctctttttctatccatccctcttcccct
cagggaaaacatgacttcatgaatgacgtggtgtctctgcgggacctgtctagtgaggag
gagattcaccactttaagaatgaaagcttaggcatggccttcctgcacctgtgccacctt
gctctcagccgcggcgtccccctggaggagatggccagagagatcagcttcgagaactgc
atccctcattccttccgacagcatatccgacagcacaatgtgctcacgcgcctgcgtctc
cgcagagtcttccgccgcttcctacgggccttccggcctggccacctctcccaacaggtt
gtgatggttaagtacttggccaccctggagcggctggctcctcgctttggctcagagcgc
atacctgtgtgtcatctggaggtcctggcacagcctgagagggacccctgctacatccag
aacagtgggcagaccactggggacccaggcccagagctgccttccgggcctcccacccac
gaggtactggtgacaggcaccggaggtatccagtggcatccactacagacccaggaatct
gagagaagtaacagcagagaaaatccccaaggcagcagccggtctgggaagaaacccaaa
ggccctgaggctggagagcgcctggcagagagtcctcaggaaccaccttggacctacttc
tgtgacttccaggacatttcccatgtggtgctaaaggagcgtcgcgtgcacatccacctc
caagacaacaagtgcttgttgctgtgcctctgttcccaggctgaggccctgtcctttgtg
gccctggtcgatggctatttccgcttgactgctgactccagccactacctgtgccatgag
gtggcccccccgaggctggtgactagcatccagaacggcatccatggacccctgatggat
ccctttgtacaggccaagctgtggccagaggatggcctctacctgattcagtggagcacc
agccacctgcaccgcctgatccttactgtggcccatcgaaacccggctcccggtaatggc
cctaggggcctgcgcctgcgcaagttccccatcacacagcagcccggagcctttgtactg
gacggctggggccgctcctttgacagcttgggggaccttcgcctcgccttgcagggctgc
tcattgcgggctggtgatgactgtttccccctgcaccactgctgcctgccccggccaaga
gaaatctccaacctcgtcatcatgcggggatccagggcccacacccggcctctcaacctc
agtcagctcagcttccacagggttcaccaagatgaaatcacccagctgtcccacttgggc
cagggcacaaggaccaatgtgtatgagggccttctaagagtgggaggccccgacgagggc
aaagtggacaatggatgtccccgcgagcctgtcggggccagtgggcagcagcttcgagtg
gtgctcaaagttctcgaccccagtcaccatgatattgccttggccttctatgagactgct
agcctcatgagccaggtgtcacacatgcacctggctttcctgcatggtgtttgcgtgcgt
ggctcagagaacatcattgtgacagaattcgtagaacatggtccgttggatgtgtggtta
cggcgacagaggggccaagtgcccatgacctggaagatggccgtggctcagcagctggcc
agcgccctcagctacctggaggacaagaatctggttcacgggaacgtatgtggccggaac
atcctgctggctcgcctggggctggaggagggtaccagccccttcatcaagctaagtgat
cctggtgtgggccaaggtgccctctccagggaagagcgagtggagcgcatcccctggaca
gctccggagtgcctgtccggagggaccagtagcttgggcactgccacggacatgtggggc
tttggtgccacccttcttgagatctgctttgatggggaggcacccctgcagggtcgtggt
ccctctgagaaagaacggttctacacaaagaaacatcagctgcctgaaccctcatgccca
gagctggccacactcactcgccagtgcctgacctatgaaccagcacagcggccatccttc
cgcaccattttgcgggacctcacaagactacagccacagaatctggtcggcatttcggct
gtgaactcagactcaccagcatcagaccccactgttttccacaagcgttatttgaaaaag
atccgggatttgggcgagggtcactttggcaaggtcagcctgtactgctacgacccaacc
aatgacggcactggggagatggtggccgtgaaggccctgaaggaggggtgcggtccccag
ctccgctcaggctggcagcgggagattgagatcctgcggacactgtaccacgaacatatt
gtcaagtataaaggctgctgtgaggaccaaggagagaagtctgtacagctggtcatggag
tacgtccctctgggcagcctccgagactacctgccaaggcacagcgtagggctggcacag
ctcctgctgtttgcccagcagatctgcgagggcatggcctacctgcatgctcagcactac
attcaccgagacctcgccgcgcgcaacgtgctgctggacaacgataggctggtcaagatt
ggagactttggcctagccaaggctgtgcctgaaggccacgagtactaccgagtgcgcgag
gacggggacagcccagtgttctggtatgccccagaatgcctgaaggagtgcaaattttac
tatgcatctgatgtctggtccttcggggtaaccctgtatgagctgttgacatactgtgac
tctaaccagagcccccacacgaaattcaccgagctcattggccatacccagggccagatg
accgtgctgaggctcacagagctgctggaacgaggagagaggctgcctcggcctgacagg
tgtccctgtgagatctatcacctcatgaagagctgctgggagacagaggcctccttccgg
cccaccttccagaatcttgtgcccatcctcaagacggcacaggagaagtaccaaggccgg
gtgccttccgtgttcagcgtgtgctga

KEGG   Mus pahari (shrew mouse): 110337003
Entry
110337003         CDS       T05929                                 

Gene name
Jak3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04062  Chemokine signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04217  Necroptosis
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah05161  Hepatitis B
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05223  Non-small cell lung cancer
mpah05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110337003 (Jak3)
   04151 PI3K-Akt signaling pathway
    110337003 (Jak3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110337003 (Jak3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110337003 (Jak3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    110337003 (Jak3)
   04659 Th17 cell differentiation
    110337003 (Jak3)
   04062 Chemokine signaling pathway
    110337003 (Jak3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337003 (Jak3)
   05203 Viral carcinogenesis
    110337003 (Jak3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    110337003 (Jak3)
  09163 Immune disease
   05340 Primary immunodeficiency
    110337003 (Jak3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110337003 (Jak3)
   05161 Hepatitis B
    110337003 (Jak3)
   05162 Measles
    110337003 (Jak3)
   05169 Epstein-Barr virus infection
    110337003 (Jak3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     110337003 (Jak3)
Protein kinases [BR:mpah01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   110337003 (Jak3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH Kdo pKID
Other DBs
NCBI-GeneID: 110337003
NCBI-ProteinID: XP_021075408
Ensembl: MGP_PahariEiJ_G0021664
LinkDB
Position
19
AA seq 1100 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKA
CGILPVYHSLFALATEDFSCWFPPSHIFSIEDVDTQVLVYRLRFYFPDWFGLETCHRFGL
RKDLTSAILDVHVLEHLFAQHRSDLVSGRLPVGLSMKDQGEFLSLAVLDLAQMAREQAQR
PGELLKTVSYKACLPPSLRDVIQGQNFVTRRRIRKTVVHALRRVVACQADRYALMAKYIL
DLERLHPAATTEAFRVGLPGAQEELGLLRVAGGNGIAWSSGDQELFQTFCDFPEIVDVSI
KQAPRVGPAGEHRLVTVTRMDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEV
APPRLLEEEAELCHGPITLDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGP
DYKGCLIRQDPSGAFSLVGLSQPHRSLRELLAACWHSGLRLDGAALNLTSCCAPRPKEKS
NLIVVRRGCTPSPAPGCSPSCCALTQLSFHTIPEDSLEWHENLGHGSFTKIFRGRRREVV
DGETHDSEVLLKVMDSRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVY
LGAIDTYLRKRGHLVSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGVDGNP
PFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEAQTLGLEADKWGFGATTWEVFSGGPA
HITSLEPAKKLKFYEDRGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSD
YELLSDPTPGIPSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPL
GDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEY
LPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVK
IADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYC
DKSCSPSAEFLRMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPQD
RPAFGTLSPQLDALWRGRPG
NT seq 3303 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacctctgatccctcagcgttcttgcagcctctcatcc
tcggaggcaggagccctgcacgtgctccttcctccccggggacctgggcctccccagcga
ctgtcattctcttttggggactacttggccgaggatctgtgtgtgcgggctgccaaggcc
tgtggcatcctgcctgtttatcattcgctcttcgctctggccaccgaggacttctcttgc
tggttccccccaagccacatcttctccatagaggacgtggacactcaagtcttggtctac
aggctacgcttttacttccctgactggtttgggctggagacatgtcaccgctttgggctg
cgcaaagatttgaccagtgccatccttgacgtacatgttttagaacatctctttgctcag
caccgcagtgacctggtgagtgggcgcctccccgtgggccttagcatgaaggaccaggga
gagttcctgagcctggcagtgctggacttggcccagatggctcgtgagcaggcccagcgc
ccaggagagctgctgaagacggtcagttacaaagcctgtctgccgcccagcctgcgcgat
gtgatccagggccagaacttcgtgactcgcaggcgcatccgcaagaccgtggtccatgcg
ctgcgccgcgtagtcgcctgccaggccgaccgctacgcgctcatggccaagtacatcctg
gacctggaacggctacatccagcggccactaccgaggccttccgtgtggggctcccgggc
gcccaggaggagctggggcttctgcgtgtggcggggggcaacggcatcgcctggagctcc
ggggatcaggagcttttccagaccttctgtgactttccggaaatcgtggatgtcagcatc
aagcaggccccacgcgtgggtcccgcaggggagcaccggctagtcaccgtcaccaggatg
gacggccacatcctggaagcggagtttccggggctgcctgaggcgctgtccttcgtggcc
ctcgtggatggatactttcgcctgatctgcgactccaggcattatttctgcaaggaggtg
gcaccgccgcggctgctggaggaggaggcggagctgtgccatggacccatcacgttagac
tttgccatacacaagctgaaggccgctggctccctcccgggcacctacattctccgccgc
agcccgcaggactatgacagctttcttcttactgcctgcgtccagactcctcttggcccc
gactacaagggctgcctcatccgccaggaccccagcggggctttctccctggtcggcctc
agccagccacacagaagcctgcgggagctgcttgcagcctgctggcattccgggctgcgc
ttagatggcgctgccctgaacctcacatcctgctgcgctcccagacccaaggaaaagtcc
aatttgatcgtggtgcgaaggggctgcaccccctcgcctgcccctggctgctccccgtcc
tgctgtgcgctgacgcagctgagcttccacacaatcccagaggacagcctggagtggcac
gagaacctgggtcacggctcttttaccaagatcttccgtggccgcaggcgggaggtcgtg
gatggtgagacacatgactcagaagtcctcctgaaggtcatggactccagacatcggaac
tgcatggagtcttttctggaagccgcaagcttgatgagccaagtatcctacccgcacctg
gtgttactgcacggcgtctgcatggctggagacagcatcatggtgcaggaatttgtgtac
ctaggagcaattgacacgtacctgcgaaagcgtggccacctggtgtcagccagctggaaa
ttgcaggtgaccaagcagctggcatatgcccttaactacttggaggacaaaggccttcct
catggcaacgtctcagcacggaaggtgctcctggctcgagagggggttgatgggaatcca
cctttcatcaagctgagtgatcctggtgtcagtcctactgtgctgagcctggaaatgctc
actgacaggattccctgggtggcccctgagtgtctccaggaagcccagacgctcggcttg
gaagctgacaagtggggctttggagccaccacgtgggaggtgttcagcgggggacccgcg
cacatcacctcgctggagcccgccaaaaagctgaagttctatgaggaccggggacagctg
cccgccctcaaatggacagaactggcggggcttatcacacagtgcatggcgtatgatcct
ggccggcgcccctccttccgagctatcctcagagacctcaacggcctcattacatcagat
tacgagctcctctcagaccccacacctggcatcccgagtccccgagatgagctgtgcggt
ggcgcccagctctatgcctgccaggaccccgccatattcgaggagagacaccttaagtac
atctccttgctgggcaagggcaactttggcagcgtggagctgtgccgctacgaccctctg
ggggacaatacgggacccctggtggcagtgaagcagctacagcacagcgggccagaccag
cagagggacttccagcgggagattcagatccttaaggctcttcacagcgactttatcgtc
aagtaccgcggagtcagctatgggcctggtcgccagagcctgcgtttggtgatggagtac
ctgcccagcggctgcctgcgggacttcctgcagcgccaccgcgcacgcctgcacaccgac
cgcctattgctgttcgcctggcagatttgcaagggcatggagtacctgggcgcgcgccgc
tgcgtgcaccgtgacctggctgcgcgcaacatcctggtggagagcgaggcgcatgtgaag
atcgcggactttggcctcgctaagctgctgcccctcggaaaggattactacgtggtccgc
gagcctggtcaaagccccatcttttggtacgccccggagtccctatcagacaacatcttc
tcccgccaatctgacgtgtggagcttcggagtggtgctgtacgagctcttcacctactgc
gacaagagctgcagtccatccgctgagtttctacgcatgatggggcctgagcgtgaagga
cccccgctctgccgccttctggagctgctggcagagggccgacgcctcccaccacctccc
acctgccccaccgaggttcaggagctcatgcagctgtgctgggcgcccagcccgcaggac
cggccagccttcggcaccctgagcccccagctggacgcgctgtggcgtggaagacccgga
tag

DBGET integrated database retrieval system