KEGG   Mus pahari (shrew mouse): 110316901
Entry
110316901         CDS       T05929                                 

Gene name
Bid
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04071  Sphingolipid signaling pathway
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04650  Natural killer cell mediated cytotoxicity
mpah04932  Non-alcoholic fatty liver disease
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110316901 (Bid)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110316901 (Bid)
   04215 Apoptosis - multiple species
    110316901 (Bid)
   04217 Necroptosis
    110316901 (Bid)
   04115 p53 signaling pathway
    110316901 (Bid)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110316901 (Bid)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316901 (Bid)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110316901 (Bid)
   05014 Amyotrophic lateral sclerosis
    110316901 (Bid)
   05022 Pathways of neurodegeneration - multiple diseases
    110316901 (Bid)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110316901 (Bid)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110316901 (Bid)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110316901 (Bid)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110316901 (Bid)
   05161 Hepatitis B
    110316901 (Bid)
   05160 Hepatitis C
    110316901 (Bid)
   05164 Influenza A
    110316901 (Bid)
   05162 Measles
    110316901 (Bid)
   05168 Herpes simplex virus 1 infection
    110316901 (Bid)
   05163 Human cytomegalovirus infection
    110316901 (Bid)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110316901 (Bid)
   05169 Epstein-Barr virus infection
    110316901 (Bid)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110316901 (Bid)
SSDB
Motif
Pfam: BID DUF3517
Other DBs
NCBI-GeneID: 110316901
NCBI-ProteinID: XP_021046913
Ensembl: MGP_PahariEiJ_G0022565
LinkDB
Position
2
AA seq 197 aa
MDSEVSNGSGLGAEYITNLLVLGFLQSSGCNPQELKVLGEQLTVQAYWEAAPYLEDELQT
DGSRASRPIDQGRIEPDSESQEEIIHSIARHLAQVGDEMDRSIQPALVSQLAAHFMNDSL
SEEDKQNCLANALDEVKPAFPRDMENDKAMLIMTMLLAKKVASHAPPLLRVVFNTTVNFI
NQNLFSYVRNLVRNEMD
NT seq 594 nt   +upstreamnt  +downstreamnt
atggactctgaggttagcaacggctctggcctgggggctgagtacatcacaaacctgctg
gtgttgggctttctccaaagctctggctgtaatccccaagagctgaaggtgctgggtgag
caactgactgtgcaagcttactgggaggcagccccatacctcgaagacgagctgcagaca
gatggcagccgggctagccgccccatcgaccaaggaagaatagagccagattctgaaagc
caggaagagatcatccacagcattgctagacatctcgcccaggtaggcgatgagatggac
cgcagcatccagcccgcgctggtgagccagctagctgcacacttcatgaatgacagcctg
tcggaggaagacaaacagaactgcctggccaacgcccttgatgaggtgaagccagccttc
cccagagacatggagaacgacaaggccatgctgataatgaccatgctgttggccaaaaaa
gtggccagtcacgcaccacctttgctccgagttgtcttcaacacgaccgtgaactttatt
aaccagaacctattctcctatgtgcggaacttggttagaaatgagatggactga

DBGET integrated database retrieval system