KEGG   Mus pahari (shrew mouse): 110317086
Entry
110317086         CDS       T05929                                 

Gene name
Cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04022  cGMP-PKG signaling pathway
mpah04024  cAMP signaling pathway
mpah04260  Cardiac muscle contraction
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04270  Vascular smooth muscle contraction
mpah04713  Circadian entrainment
mpah04720  Long-term potentiation
mpah04723  Retrograde endocannabinoid signaling
mpah04724  Glutamatergic synapse
mpah04725  Cholinergic synapse
mpah04726  Serotonergic synapse
mpah04727  GABAergic synapse
mpah04728  Dopaminergic synapse
mpah04742  Taste transduction
mpah04911  Insulin secretion
mpah04912  GnRH signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04924  Renin secretion
mpah04925  Aldosterone synthesis and secretion
mpah04927  Cortisol synthesis and secretion
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04934  Cushing syndrome
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05031  Amphetamine addiction
mpah05410  Hypertrophic cardiomyopathy
mpah05412  Arrhythmogenic right ventricular cardiomyopathy
mpah05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110317086 (Cacna1c)
   04020 Calcium signaling pathway
    110317086 (Cacna1c)
   04024 cAMP signaling pathway
    110317086 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    110317086 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110317086 (Cacna1c)
   04929 GnRH secretion
    110317086 (Cacna1c)
   04912 GnRH signaling pathway
    110317086 (Cacna1c)
   04921 Oxytocin signaling pathway
    110317086 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    110317086 (Cacna1c)
   04924 Renin secretion
    110317086 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    110317086 (Cacna1c)
   04927 Cortisol synthesis and secretion
    110317086 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    110317086 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    110317086 (Cacna1c)
   04270 Vascular smooth muscle contraction
    110317086 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    110317086 (Cacna1c)
   04727 GABAergic synapse
    110317086 (Cacna1c)
   04725 Cholinergic synapse
    110317086 (Cacna1c)
   04728 Dopaminergic synapse
    110317086 (Cacna1c)
   04726 Serotonergic synapse
    110317086 (Cacna1c)
   04720 Long-term potentiation
    110317086 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    110317086 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    110317086 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110317086 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110317086 (Cacna1c)
   05020 Prion disease
    110317086 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    110317086 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    110317086 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110317086 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    110317086 (Cacna1c)
   05414 Dilated cardiomyopathy
    110317086 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110317086 (Cacna1c)
   04934 Cushing syndrome
    110317086 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mpah04040]
    110317086 (Cacna1c)
Ion channels [BR:mpah04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110317086 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 110317086
NCBI-ProteinID: XP_021047103
Ensembl: MGP_PahariEiJ_G0022543
LinkDB
Position
2
AA seq 1958 aa
MVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGR
QCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIY
FVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQA
EDIDPENEDEGMDEDKPRNRGAPAGLHDQKKGKFAWFSHSTETHVSMPTSETESVNTENV
AGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNIFYWLVIFLVFLNTL
TIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGG
ILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLF
LFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAY
GGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLA
RTASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSN
PDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVND
TIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFL
HKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVV
QCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDG
EVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYR
VEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPL
RRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFT
GLFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVHPAEHTQCSPSMVRTT
LQTTFPASVASPLATHVLSTPISRALGTQPSSHCMWPPCPLCALTACAHVSCARSAEENS
RISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQV
FGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNST
EGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIW
AEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNAT
LFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYAT
FLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDK
AMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDSRSNFPQTFATQRPLHINKTGNNQADTE
SPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPAGYSSTVSTVESHGPPLSPA
VRVQEAAWKLSSKRYHSRESQGATVSQEMFPDETHSVRMSEEAEYCSEPSLLSTDILSYQ
EDENRQLTCPEEDKRENQPSPKRGFLRSASLGRRASFHLECLKRQKDQGGDISQKTALPL
HLVHHQALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPGSQGRPLRPIPTLRLEGAESSEK
LNSSFPSIHCGSWSEETTACSGGSSMARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVL
ISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNCR
DPGQDRAVVPEDESCAYALGRGRSEEALSDSRSYVSNL
NT seq 5877 nt   +upstreamnt  +downstreamnt
atggtgcctctgctgcacatcgctcttcttgtactcttcgtcatcatcatttatgccatc
atcggcctggagctcttcatgggaaagatgcacaagacctgctacaaccaggagggcata
atagatgttccggcagaagaggatccttccccttgtgctttggagacaggccatgggcga
cagtgtcagaatgggaccgtgtgcaaacccgggtgggatgggcccaagcacggcatcacc
aacttcgacaacttcgccttcgccatgctcacggtgttccagtgtatcaccatggagggc
tggacagacgtgctgtactgggtcaatgatgccgtaggaagggactggccctggatctat
tttgtaacactaatcatcatagggtcattttttgtacttaacttggttctcggtgttctt
agcggggagttttccaaagagagggagaaagccaaagcccgaggagatttccagaagctt
cgagagaagcagcagctggaagaagatctcaaaggctacctggactggatcacccaggca
gaagacatagaccctgagaacgaggacgagggcatggatgaagacaagcctcgaaacaga
ggcgctccagcgggcttgcatgatcagaagaaagggaaatttgcttggtttagtcactct
acagaaacccatgtgagcatgcccacaagcgagactgagtctgtcaacactgaaaatgtg
gctggaggtgacatcgagggtgaaaactgtggagccaggcttgcccaccggatctccaaa
tccaagttcagccgctactggcgcaggtggaatagattctgcagaagaaagtgccgtgca
gcagttaagtccaacatcttctactggctcgtcatcttcctggtgttcctcaacaccctc
accattgcctccgaacattacaaccagcctcactggctcacagaagtgcaagacacggcc
aacaaggccctcctggcccttttcacggcagaaatgctcctgaagatgtacagcctgggt
ctgcaggcctattttgtgtccctcttcaaccgcttcgactgtttcattgtgtgtgggggc
attctggagaccatcctggtggagacgaagatcatgtcccccctgggcatctctgtgctg
agatgtgtgcggctgctcaggatctttaagatcaccaggtactggaactccttgagcaac
cttgtggcatccttgctgaactcagtgcgctccatcgcctccctgctgctgctcctcttc
ctcttcatcatcatcttctccctcctggggatgcagctctttggagggaagttcaacttc
gatgagatgcagacccgtaggagcacgttcgataacttcccgcagtccctcctcactgtg
tttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttat
ggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgt
ggaaattatatcctactgaacgtgttcttggccattgcggtggacaacctggccgatgca
gagagcctgacctcagcccaaaaggaggaggaagaagagaaggagaggaagaagctggcc
aggactgccagcccagaaaagaaacaggaggtgatggagaagccagcagtggaggagagc
aaagaggagaaaattgaactgaagtccattacagcagatggagaatccccacccactacc
aagatcaacatggatgacctccaacccagtgaaaacgaggataagagtccccactccaac
ccagacactgcaggggaagaggatgaagaggagccggagatgcctgtggggccacgcccc
cggcccctgtctgagctgcaccttaaggaaaaggcagtccccatgccggaagccagtgca
tttttcatcttcagcccaaacaacaggttccgcctgcagtgccaccgcattgtcaatgac
acgatcttcaccaacctcatcctcttcttcattctgctcagcagcatctctctggctgct
gaggaccccgtccagcacacctccttcaggaaccatatcctaggcaatgcagactatgtc
ttcactagtatctttacattagaaattatccttaagatgactgcttatggggctttcctg
cacaagggctctttctgccgaaattacttcaatatcctggacctgctggtggttagcgtg
tccctcatctcctttggcatccagtccagtgcaatcaatgttgtgaagattttacgagtg
cttcgagtcctcaggccgctgagggccatcaacagggccaaggggctaaagcatgtggtt
cagtgcgtgtttgtggccatccggaccatcgggaacatcgtaattgtcaccactctgctg
cagttcatgttcgcctgcattggggtccagctcttcaagggaaagctctatacctgttcg
gatagttctaaacagacggaggcagaatgcaagggtaactatatcacatacaaagatggg
gaggttgatcaccccattatccagcctcgaagctgggagaacagcaagtttgactttgac
aatgttctggcagccatgatggctctcttcaccgtctccaccttcgaagggtggccagag
ctgctgtaccgctccattgactcccacacagaagacaagggccccatctacaactaccgt
gtagagatctccatcttcttcatcatctacatcatcatcattgccttcttcatgatgaac
atcttcgtgggtttcgtcattgtcaccttccaggagcagggggaacaagagtacaagaac
tgtgagctggacaagaaccagagacagtgtgtggaatatgccctcaaggcccgacccttg
cgaaggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactctacc
tacttcgagtatctgatgttcgttctcatcctgctcaacaccatctgcctggccatgcag
cactatggccagagctgcctcttcaaaattgccatgaatatactcaacatgctcttcact
ggcctcttcacggtggagatggttctgaagctcattgccttcaaacccaagcactatttc
tgtgatgcatggaatacatttgacgccttgattgttgtgggtagcattgttgatatagca
atcaccgaggtacacccagctgaacatacccaatgctctccctctatggtaagaacaacc
ctccagaccacatttccagcttctgtggcttcccctctagccacccacgtcttatccacc
ccgatttccagagccctgggaacccagcccagctcccattgcatgtggccaccatgtccg
ttgtgtgccctaactgcctgtgctcacgtgagctgtgcaaggagtgcagaggagaactcc
cgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtgaagctgctgagc
cgcggggaaggcatccgaaccctgctgtggaccttcatcaagtccttccaggccctgccc
tatgtggcccttttgattgtgatgctgttctttatctatgcggtgattgggatgcaggtg
tttgggaagattgccctgaatgacaccacagagatcaatcggaacaacaacttccagacg
ttcccccaggctgtgctactgctgttcaggtgtgccactggggaggcctggcaggacatc
atgctggcctgcatgccaggcaagaagtgtgccccagagtctgagcccagcaacagcacg
gaaggggagaccccctgtggtagcagctttgctgtcttctacttcatcagcttctacatg
ctctgtgccttcctgatcatcaacctctttgtagctgttatcatggacaactttgactac
ctgactagggattggtctatccttggtccccatcacctggatgaattcaagagaatctgg
gccgagtatgaccctgaagccaagggtcggatcaaacacttggatgtggtgaccctcctc
cgtcgaattcagcccccactgggttttgggaagttgtgtcctcaccgtgtggcctgcaaa
cgcctggtgtccatgaacatgcctctgaacagcgatggcacagtcatgttcaatgctacg
ctgtttgccctcgtcaggacagccctgaggatcaaaacagaagggaacctagagcaagcc
aatgaggagctgcgggccatcatcaagaaaatctggaagaggaccagcatgaagctgttg
gaccaggtggtgccccctgcaggtgatgacgaggtcacagtgggcaagttctatgccacc
ttcctgatccaagagtacttcaggaaattcaagaagcgaaaagagcaggggctggtgggc
aagccctcacagaggaatgcactgtccctccaggctggcttacgcaccttgcatgacatt
gggcctgagatccggagggccatctctggggatctgactgctgaggaagagttggacaag
gctatgaaggaggcagtgtctgctgcctccgaagatgacatcttcaggagggctggaggc
ctgttcggcaaccacgtcagctactatcagagtgacagcaggagcaactttcctcagacg
ttcgccacccagcgcccactgcacatcaacaagacggggaacaaccaagctgacaccgag
tcaccatcccatgagaagctggtggactccacgttcacccccagcagttactcatccacg
ggctctaatgccaacatcaacaatgccaacaacactgccctgggccgcttcccccatccc
gctggctactccagcacggtcagcactgtggagagccatgggcctcccttgtcccctgct
gtccgggtacaggaggcagcctggaagctcagctctaagaggtaccactcccgggagagc
cagggggccacggtgagtcaggagatgtttccggatgagacccacagcgtgaggatgagt
gaagaagccgagtactgcagtgagcccagcctgctctccacagacatactctcctaccag
gaggatgaaaaccgacaactgacctgcccggaggaggataagagggagaaccagccatct
ccaaagaggggtttccttcgctctgcctctctaggtcgaagggcctccttccatctggaa
tgtctaaagcgacaaaaggatcaagggggagacatctctcagaagacagccttgcccttg
catctggttcatcatcaggcattggcagtggcaggcttgagcccccttctgcagagaagc
cattctcctaccacattccccaggccgtgcccaacaccccctgtcactccaggcagccag
ggcaggcccctacggcccatccctaccctaaggctggaaggggcggagtccagcgagaaa
ctcaacagcagcttcccatccatccactgcggctcctggtctgaggagacgacagcctgc
agtgggggcagcagcatggcccggagagcccggcctgtctccctcactgtgcccagccag
gctggagctccagggagacagttccatggcagcgccagcagcctggtggaagcggtcttg
atttcagaaggactgggacagtttgctcaagatcccaagttcatcgaggtcaccacccag
gagctggctgacgcctgcgacatgacaatagaggagatggagaacgctgcagacaacatc
ctcagtgggggagcccagcagagccccaacggcaccctcttaccttttgtgaactgcagg
gacccggggcaggacagggctgtggtcccagaggacgaaagctgcgcatatgccctgggg
cgtggccggagcgaggaggcgctctcggacagcaggtcctacgtcagcaacctgtag

DBGET integrated database retrieval system