KEGG   Mus pahari (shrew mouse): 110317578
Entry
110317578         CDS       T05929                                 

Gene name
Stam
Definition
(RefSeq) signal transducing adapter molecule 1
  KO
K04705  signal transducing adaptor molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110317578 (Stam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110317578 (Stam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110317578 (Stam)
Membrane trafficking [BR:mpah04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    110317578 (Stam)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10 HEAT_2 GGA_N-GAT
Other DBs
NCBI-GeneID: 110317578
NCBI-ProteinID: XP_021047729
Ensembl: MGP_PahariEiJ_G0024648
LinkDB
Position
3
AA seq 557 aa
MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVATKKEEEDLAKAI
ELSLKEQRQQSAPLSTLYPSTSNLLANHHHDGRKVRAVYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDNQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYMQSSGVSASQVYPGPAQSGTYLVAGNA
QMTHLQSYSLPPEQLSSISQGAVPPSANQALPSQQTQASYPNAMVSSVQGNSYPSQASIY
SPPPPPPSAAAAAAAAVVPVPVPAAVPVPADVTIYQNAGPNMSQVPNYTLTSSTLPQTGG
SQQPPQPQQAYSQKALL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgcctctctttgccaccaaccccttcgaccaggatgttgagaaagcaactagtgagttg
aatactgctgaggactggggcctcatcttggatatttgtgataaggttggccaatctcgt
acaggacctaaagattgtcttcgttctattatgagaagagtgaaccataaagacccccat
gttgctatgcaagctttaactcttctaggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtttgatatcggcaatgatcaagaaccttaaggaacaaggtgta
acattcccagctattggctctcaggctgcagagcaagcaaaagcaagccctgctctggta
gccaaggaccctgggactgtggctaccaaaaaggaagaagaagatttagcaaaagctatt
gagttgtccctcaaggagcaaagacagcagtcagcgccgctctccacgctgtatcccagc
acatctaatctcctcgctaaccaccaccacgacggcagaaaggtccgcgctgtgtatgat
tttgaagctgctgaggataatgagcttacttttaaagctggagaaattattacagtcctt
gatgacagtgatcccaactggtggaaaggtgaaacccatcaaggcatggggctttttcct
tctaattttgtaactgcagatcttactgctgaaccagaaatgattaaaacagagaagaag
acggtacagttcagtgatgatgttcaggtagagacaatagaaccagaaccagaaccagcc
tttattgatgaggataaaatggaccagttgttacagatgttgcaaagtacagatcccagt
gataatcagccagacttaccagagctacttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaacta
aatgtgaaggtgatggaagctctttcgttgtatacaaagttaatgaatgaagatccaatg
tattctatgtatgcaaaattacagaatcagcagtattatatgcagtcgtctggcgtttct
gcttcccaggtatatccagggcctgctcagagtggtacctacctggttgcagggaatgca
cagatgacccatctgcagagctacagccttcccccagagcagctatcttctatcagccaa
ggagcagttccaccctctgcaaaccaggctcttcctagtcagcagacccaggcttcttac
ccgaatgcaatggttagttctgttcaaggaaattcgtatcctagccaggcttcaatatat
agtcctcctcctcctcctccttctgctgctgctgctgctgctgctgctgtggtacctgtt
cctgtacctgctgctgtacctgtacctgctgatgtcaccatataccagaatgcaggacct
aatatgtcccaggtgccaaactatactttaacatcatcaaccctgcctcaaacaggaggc
agccaacagccacctcagccacagcaagcatattctcagaaggctctgctatag

KEGG   Mus pahari (shrew mouse): 110318348
Entry
110318348         CDS       T05929                                 

Gene name
Stam2
Definition
(RefSeq) signal transducing adapter molecule 2 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04144  Endocytosis
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110318348 (Stam2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110318348 (Stam2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110318348 (Stam2)
Membrane trafficking [BR:mpah04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    110318348 (Stam2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10 ENTH
Other DBs
NCBI-GeneID: 110318348
NCBI-ProteinID: XP_021048992
Ensembl: MGP_PahariEiJ_G0025010
LinkDB
Position
3
AA seq 528 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDRVGSTPSGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRSVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGVTFPSAGSQTVSAAAKNGTSLNKNKEDEDIAKAIELSLQE
QKQQYTETKALYPPAESQLNNKAARRVRALYDFEAAEDNELTFKHGEIITVLDDSDANWW
EGENHRGTGLFPSNFVTTDLSSEAETATVDKLNVIDGDVEEIKKSEPEPVYIDEGKMDRA
LQILQSIDPKDSNPDSQDLLDLEDICQQMGPMIDEKLEEIDRRHSELSELNVKVLEALDL
YNKLVNEAPVYSVYSKLHPAHYPPAAAAAAAAGVPVQTYPVQSHGGNYLGHGIHQVSVAQ
NYNLGPDPMGSLRSLPPNMNSVTAHTVQPPYLSTGQDTVSNPSYMTLSSRLQAAAGTAAY
TQPVGMSADVSSFQNTASGLPQLAGFPVAVSAPPAAQPPASYHQQPLL
NT seq 1587 nt   +upstreamnt  +downstreamnt
atgcctctgttcactgccaacccgttcgagcaagatgtggaaaaagccacaaatgagtac
aacaccacagaagactggagtctgatcatggacatctgtgacagggttggaagcactccc
agtggagcaaaagattgcctaaaagccataatgaaaagggtaaaccataaggttcctcac
gttgctctgcaggcgctaacccttcttggagcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacggaagtacgttctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactaaaatctctaatggtggagtggtcagaagaattc
cagaaggacccccagtttagtctgatatctgcaactattaagtctatgaaagaagaaggg
gttacttttccttcagcaggctcccagactgtctcggctgctgccaaaaacgggacatca
ttgaacaaaaacaaagaagatgaggacatagctaaagctattgagttatcattgcaagag
cagaagcaacagtacacggagacaaaggctttgtacccacctgcagagagtcagttaaat
aacaaggctgcacggagagtcagagctttatacgactttgaagctgctgaggacaacgaa
ctcacctttaaacatggtgagatcattactgttttggatgacagtgacgccaactggtgg
gaaggagagaatcacagaggaacaggactcttcccctccaactttgtaacgactgactta
agctcagaggctgagacagcaacggtggacaaattgaatgtaattgatggtgatgtggag
gaaattaagaaatcagaacctgagcctgtttatatagatgagggtaaaatggatagagcc
ctgcagattctccagagcatagatccaaaagattcaaaccccgactcccaagacctcttg
gacttggaagatatttgccaacagatgggtccgatgatagatgaaaaactggaagagatt
gataggaggcattcagaactgtctgagttgaatgtaaaggtgctggaagccctggaccta
tacaacaagttggtgaatgaagcgcctgtgtactcggtctattcaaagctgcacccggca
cattacccgcccgcagcagcagcagcagcagcagctggggttccagtacagacatatcca
gtccagtcgcatggtggaaactacctgggtcacggcattcaccaagtgtctgttgcccag
aactataacctaggacctgatcctatgggctcgctgagatctctgcctccaaacatgaac
tcagtaacagcacacaccgtccaacctccatacttaagcactggacaggacactgtctcc
aatccttcttacatgaccctgagctctcgtcttcaggcagctgctgggacagctgcttac
acacagcccgtagggatgtctgcagatgtgtcttctttccagaacacagcatccggtctg
cctcagctggccggctttccagtggcagtttctgcacctccagctgcacagccaccagca
agctaccaccagcagccactcctgtag

DBGET integrated database retrieval system