KEGG   Mus pahari (shrew mouse): 110318109
Entry
110318109         CDS       T05929                                 

Gene name
Bmp7
Definition
(RefSeq) bone morphogenetic protein 7 isoform X1
  KO
K16621  bone morphogenetic protein 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110318109 (Bmp7)
   04390 Hippo signaling pathway
    110318109 (Bmp7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110318109 (Bmp7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110318109 (Bmp7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110318109 (Bmp7)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110318109 (Bmp7)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110318109 (Bmp7)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110318109 (Bmp7)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110318109
NCBI-ProteinID: XP_021048526
Ensembl: MGP_PahariEiJ_G0026183
LinkDB
Position
3
AA seq 430 aa
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEESGPDGQGFSYPYKAVFSTQGPPLASL
QDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYI
RERFDNETFQITVYQVLQEHSGRESDLFLLDSRTIWASEEGWLVFDITATSNHWVVNPRH
NLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHLRSIRSTGGKQRSQ
NRSKTPKNQEALRMASVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEG
ECAFPLNSYMNATNHAIVQTLVHFINPDTVPKPCCAPTQLNAISVLYFDDSSNVILKKYR
NMVVRACGCH
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgcacgtgcgctcgctgcgcgctgcggcgccacacagcttcgtggcgctctgggcgcct
ctgttcttgctgcgctccgccctggccgatttcagcctggacaacgaggtgcactccagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgggagatcctgtcc
atcttggggttgccccatcgcccgcgcccgcacctccagggaaagcataattcggcgccc
atgttcatgttggacctgtacaacgccatggcggtggaggagagcgggccggacggacag
ggcttctcctacccctacaaggccgtcttcagtacccagggtccccctttagccagcctg
caggatagccacttcctcaccgacgccgacatggtcatgagcttcgtcaacctagtggag
cacgacaaagaattcttccaccctcgataccaccatcgggagttccggtttgatctttcc
aagatccccgaaggcgaagcggtgaccgcagccgaattcaggatctataaggactacatc
cgggagcgatttgacaatgagaccttccagatcacagtctatcaggtgctccaggagcac
tcaggcagggagtcggacctcttcttgctggacagccgcaccatctgggcttctgaggag
ggctggttggtgtttgatatcacagccaccagcaaccactgggtggtcaaccctcggcac
aacctgggcttacagctctctgtggagaccctggatgggcagagcatcaaccccaagttg
gcaggcctgattggacggcatggaccccagaacaagcaacccttcatggtggccttcttc
aaggccacggaggtccatctccgtagcatccggtccacggggggcaagcagcgcagccaa
aaccgctccaagacgccaaagaaccaagaggccctgaggatggccagtgtggcagaaaac
agcagcagtgaccagaggcaggcctgcaagaaacacgagctgtacgtcagcttccgagac
ctgggctggcaggactggatcatcgcacctgaaggctatgctgcctactactgtgaggga
gagtgtgccttccctctgaactcctacatgaatgccaccaaccacgccatcgtccagaca
ctggttcatttcatcaacccagacacagtacccaagccctgctgcgcgcccacccagctc
aacgccatctctgtcctctacttcgacgacagctctaatgtcatcctgaagaagtacagg
aacatggtggtccgggcctgcggctgccactag

KEGG   Mus pahari (shrew mouse): 110318284
Entry
110318284         CDS       T05929                                 

Gene name
Bmp2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110318284 (Bmp2)
   04390 Hippo signaling pathway
    110318284 (Bmp2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110318284 (Bmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318284 (Bmp2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110318284 (Bmp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110318284 (Bmp2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110318284 (Bmp2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110318284 (Bmp2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110318284 (Bmp2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110318284
NCBI-ProteinID: XP_021048854
Ensembl: MGP_PahariEiJ_G0025794
LinkDB
Position
3
AA seq 394 aa
MVAGTRCLLVLLLPQVLLGGAAGLIPELGRKKFAAASGRPLSRPSDDVLSEFELRLLSMF
GLKQRPTPSKDVVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEEAVEEL
PELSGKTARRFFFNLSSVPTDEFLTSAELQIFREQIQEALGNSSFQHRINIYEIIKPAAA
SLKFPVTRLLDTRLVTQNTSQWESFDVTPAVMRWTAQGHTNHGFVVEVAHLEEKPGVSKR
HVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLY
VDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACCV
PTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagtgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattccggagctgggccgcaagaagttcgccgcggcatccggccgaccc
ttgtcccggccttcggacgacgtcctcagcgaatttgagttgaggctgctcagcatgttt
ggcttgaagcagagacccacccccagcaaggacgtcgtggtgcccccctatatgctagac
ctgtaccgcaggcactcgggccagccaggagcgcccgccccagaccaccggctggagagg
gcagccagccgcgccaacaccgtgcgcagcttccatcacgaagaagccgtggaagaactt
ccagaattgagtgggaaaacggcccgacgcttcttcttcaatttaagctctgtacccact
gacgagtttctcacatctgcagaactccagattttccgggaacagatacaggaagcttta
ggaaacagtagtttccagcaccgaattaatatttatgaaattataaagcctgcagcagcc
agcttgaaatttcctgtgaccagactattggacaccaggttagtgactcagaacacaagt
cagtgggagagcttcgacgtcaccccggctgtgatgcggtggaccgcgcagggacacacc
aaccatgggtttgtggtggaagtggcccatttagaggagaagccaggtgtctccaagaga
catgtgaggattagcaggtctttgcaccaagatgaacacagctggtcacagataaggcca
ctgctagtgacttttggacacgacggaaaaggacatccactccacaaacgagaaaagcgt
caagccaaacacaaacagcggaagcgcctcaagtccagctgcaagagacaccctttgtat
gtggacttcagtgatgtggggtggaatgactggatcgtggcacctccgggttatcatgcc
ttttactgtcacggggagtgtccgtttcccctggctgaccacctgaactccactaaccat
gccatagtgcagactctggtgaactctgtgaattccaaaatccctaaggcatgctgtgtc
cctacggagctcagcgcaatctccatgttgtacctagatgaaaatgaaaaggttgtgcta
aaaaattatcaggacatggttgtggagggttgcgggtgtcgttag

KEGG   Mus pahari (shrew mouse): 110318839
Entry
110318839         CDS       T05929                                 

Gene name
Gdf5
Definition
(RefSeq) growth/differentiation factor 5
  KO
K04664  growth differentiation factor 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110318839 (Gdf5)
   04390 Hippo signaling pathway
    110318839 (Gdf5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110318839 (Gdf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110318839 (Gdf5)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110318839 (Gdf5)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 110318839
NCBI-ProteinID: XP_021049789
Ensembl: MGP_PahariEiJ_G0025988
LinkDB
Position
3
AA seq 495 aa
MRLPKLLTFLLWYLVWLDLELICTVLGAPDLGQRTPGARPGLTKAEAKERPPLARNVFRP
GGHSYGVGATNARAKGSSGQTQAKKDEPRKMPPRSGGSETKPGPSPQTRQAAARTVTPKG
QLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRK
GGNSSVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISALEKDGLLGAELRILRKKP
LDVAKPAVPSSGRVTQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRNFKNS
AQLCLELEAWERGRAVDLRGLGFERAARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDD
KTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEA
FHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVV
YKQYEDMVVESCGCR
NT seq 1488 nt   +upstreamnt  +downstreamnt
atgagactccccaaactcctcacttttttgctttggtacctggtgtggctggacctggaa
ctcatctgcactgtgttgggtgcccctgacttaggccagagaaccccaggagccaggcca
gggttgaccaaagcggaggccaaggagaggccacccctggccaggaatgtctttaggcca
gggggtcatagctatggtgtgggggccaccaatgccagggcaaagggaagctctgggcag
acacaggccaagaaggatgaacccagaaagatgccccccagatccggtggctctgaaacc
aagccaggaccctctccccagactagacaggctgcagcccggactgtaaccccaaaagga
cagctccctgggggcaaagcatcttcaaaagcaggatctgcccccagctccttcttgctg
aagaagaccagggagcctgggacccctcgagagcccaaggagccgtttcgcccgcccccc
atcacaccccacgaatacatgctctcactgtataggacgctgtccgatgctgacagaaag
ggaggtaacagcagcgtgaagttggaggctggcctggccaacaccatcaccagctttatt
gacaaagggcaagatgaccgaggccctgcggtcaggaagcagaggtacgtgtttgacatc
agtgccttggagaaggatgggctgttgggggctgaactgcggatcttacggaagaagccc
ttggacgtggccaagccagcggtccccagtagcgggcgggttacccagctgaagctgtcc
agctgccccagcggccggcagccggcagccttgctggatgtgcgctccgtgccaggcctg
gatggatctggctgggaggtgttcgacatctggaaactcttccgaaattttaagaactca
gcgcagctgtgcctggagctggaggcctgggaacggggccgggccgtggacctccgtggc
ctgggctttgaacgcgctgcccgacaggtccacgagaaagccctgttcctagtgtttggt
cgtaccaagaaacgggacctgttctttaatgagattaaggcccgctctggccaggatgac
aagactgtgtatgaatatttgttcagccagcggcggaaacgccgggccccattggccaat
cgccagggcaagcgacccagcaagaacctcaaggctcgctgcagtcgcaaggccttgcat
gtcaacttcaaggacatgggctgggacgactggatcatcgcaccccttgagtatgaggcc
ttccactgcgaaggactgtgtgagttccccttgcgctcccacttggagcccacaaaccac
gcagtcattcagaccctgatgaactctatggaccctgaatccacaccgcctacctgttgt
gtgcctacacggctgagtcccattagcatcctcttcattgactctgccaacaacgtggtg
tataaacagtacgaggacatggtcgtggaatcttgtggctgcaggtag

KEGG   Mus pahari (shrew mouse): 110323468
Entry
110323468         CDS       T05929                                 

Gene name
Bmp8a
Definition
(RefSeq) bone morphogenetic protein 8A isoform X1
  KO
K16622  bone morphogenetic protein 8
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110323468 (Bmp8a)
   04390 Hippo signaling pathway
    110323468 (Bmp8a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110323468 (Bmp8a)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    110323468 (Bmp8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110323468 (Bmp8a)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110323468 (Bmp8a)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110323468
NCBI-ProteinID: XP_021056362
Ensembl: MGP_PahariEiJ_G0028766
LinkDB
Position
6
AA seq 412 aa
MAVRPGPLWLLGLALCALGGGHGPRPPHTCPQRRLGARERRDMQREILAVLGLPGRPRPR
APPAAARQPASAPLFMLDLYHSMTDDDDGGPPQAHLGRADLVMSFVNMVERDXALGYQEP
HWKEFHFDLTQIPAGEVVTAAEFRIYKEPSTXPLNTTLHISMFEXVQEYSNRESDLFFLD
LQTLRSGDEGWLVLDITAASDRWLLNHHKDLGLRLYVETSDGHSMDPGLAGLLGRQAPRS
RQPFMVTFFRASQSPVRSPRAARPLKRRQPKKTNELPHPNKLPGIFDDGHGSRGREVCRR
HELYVSFRDLGWLDWVIAPQGYSAYYCEGECAFPLDSCMNATNHAILQSLVSTTVACCDR
WGGVHLMKPDVVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggctgtgcgtcccggaccactctggctattgggccttgctctgtgcgcgctgggaggc
ggccacggtccgcgtcccccgcacacctgtccccagcgtcgcctgggagcgcgcgagcgc
cgcgacatgcagcgtgaaatcctggcggtgctcggactacccggacggccccgaccccgt
gcaccacccgccgctgcccggcagccagcgtccgcgcccctcttcatgttggacctatac
cactccatgaccgatgacgacgacggcgggccaccacaggctcacttgggccgtgccgac
ctggtcatgagcttcgtcaacatggtggagcgcgaccntgccctgggctaccaggagcca
cactggaaggaattccactttgacctaacccagatccctgctggggaggttgtcacagct
gctgagttccggatctacaaagagcccagcaccnacccgctcaacacaaccctccacatc
agcatgttcgaagnggtccaagagtactccaacagggagtctgacttgttctttttggat
cttcagacgctccgatctggggacgagggttggctggtgctggacatcacagcagccagt
gaccgatggctgctgaaccatcacaaggacctgggactccgcctctatgtggaaacctct
gatgggcacagcatggatcctggcctggctggtctgcttggacgacaagctccacgctcc
agacagcctttcatggtaaccttcttcagggccagccagagtcctgtgcggtcccctcgg
gcagcgagaccactgaagaggaggcagccaaagaaaactaacgagcttccgcatcccaac
aaactcccagggatctttgatgacggccacggttcccgcggcagagaggtttgccgcagg
catgagctctacgtcagtttccgtgaccttggctggctggactgggtcatcgctccccag
ggctactccgcctattactgtgagggggagtgtgctttcccactggactcctgtatgaat
gccaccaaccatgccatcttgcagtctctggtcagtaccaccgtagcctgctgcgacagg
tggggtggggtgcacctgatgaagccagatgttgtccccaaggcatgctgtgcacccacc
aaactgagtgccacctctgtgctctactatgacagcagcaacaacgtcatcctgcggaag
caccgtaacatggtggtcaaggcctgtggctgccactga

KEGG   Mus pahari (shrew mouse): 110324858
Entry
110324858         CDS       T05929                                 

Gene name
Gdf7
Definition
(RefSeq) growth/differentiation factor 7 isoform X1
  KO
K20013  growth differentiation factor 7
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110324858 (Gdf7)
   04390 Hippo signaling pathway
    110324858 (Gdf7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110324858 (Gdf7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110324858 (Gdf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110324858 (Gdf7)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110324858 (Gdf7)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 110324858
NCBI-ProteinID: XP_021058234
Ensembl: MGP_PahariEiJ_G0029357
LinkDB
Position
7
AA seq 456 aa
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPAWSPGGGGGGRTLARAPGPSALQA
AAVPGPRAVRRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPVAAVSGHGRVDTITGFTDQA
TQDETAAEPGQSFLFDVSSLSDADELVNAELRVLRRRSPEPDRDTATLPPRLLLSTCQDE
AGTAHLLHSRAAEPLAGARWEAFDVTDAVQSHRRWPRASRKFCLVLRAVTGSESSPLALR
RLGFGWPGGGDGGGTAAEERALLVISSRSQRKESLFREIRAQARALRAAAEPPPDPGPGA
GSRKATLGGRRRRRTALAGTRGAQGSGGGGGGGGGGGGGGGAAGRGHGRRGRSRCSRKPL
HVDFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASC
CVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggacctgagcgctgccgccgcgctgtgtctctggctgctgagcgcttgccgtccccgc
gacgggctcgaagctgccgcggtgctccgagcggcgggggcaggaccagcctggagcccc
gggggcggcggcggcgggaggaccctcgcccgggctccaggcccttcagctctccaggcc
gctgcggtcccgggtccccgagctgtgcgccgcgctgcgggttctggcttcaggaacggc
tcggtagtgccacaccacttcatgatgtcgctttacaggagcctggcggggagggctccg
gtcgcggcagtttcagggcacgggcgcgtggacacgatcaccggcttcacagaccaagca
actcaagacgaaaccgcggccgagccaggccagagcttcctgttcgacgtatccagcctc
tcggacgccgacgagttggtgaatgcggagctgcgcgtgctgcgccggaggtctccggag
ccggacagggacactgcgaccctccctccgcggctgctgctgtccacgtgccaggacgag
gctggcacagctcacctgctgcactcccgggccgccgagcccctggccggcgcgcgctgg
gaagcgttcgacgtgacagacgcggtgcagagccaccgccgctggccgcgcgcctcccgc
aagttctgcctggtgctgcgcgcggtgacgggctcggagagcagcccgctggccctgaga
cggttggggttcggctggccgggcggtggcgacggcggcggcacggccgctgaggagcgc
gcgctgttggtgatctcttcccgttcgcaaaggaaagagagtctgttcagggagatccga
gcccaggcccgcgctctccgggccgctgcagagccgccaccggatccaggaccaggcgct
gggtctcggaaagccaccctgggcggtcgcaggaggcggcggaccgcgctggctgggact
cggggagcgcagggaagcggtggtggtggtggtggtggtggtggtggtggtggtggcggc
ggtgccgcaggcaggggccatgggcgcagaggtcggagccgctgcagtcgcaagccactg
cacgtggactttaaggagctgggctgggacgactggatcatcgcgcctttagactacgag
gcataccactgcgagggcgtttgcgactttccgctgcgctcgcacctggagcctaccaac
cacgccatcattcagacgctgctcaactccatggcgccagacgctgctccagcctcctgc
tgcgtgcctgcacggctcagtcccatcagcatcctctacattgacgctgccaacaacgtg
gtctacaagcagtacgaagacatggtggtggaggcctgcggctgcaggtag

KEGG   Mus pahari (shrew mouse): 110325391
Entry
110325391         CDS       T05929                                 

Gene name
Bmp4
Definition
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04919  Thyroid hormone signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110325391 (Bmp4)
   04390 Hippo signaling pathway
    110325391 (Bmp4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110325391 (Bmp4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325391 (Bmp4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110325391 (Bmp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110325391 (Bmp4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110325391 (Bmp4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110325391 (Bmp4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110325391 (Bmp4)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110325391 (Bmp4)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110325391 (Bmp4)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Morphogens
   110325391 (Bmp4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110325391
NCBI-ProteinID: XP_021059014
Ensembl: MGP_PahariEiJ_G0030173
LinkDB
Position
8
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRS
FHHEEHLENIPGTSESSAFRFFFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRIN
IYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVT
HLHQTRTHQGQHVRISRSLPQGSGDWAQLRPLLVTFGHDGRGHTLTRQRAKRSPKHHPQR
SRKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagaccgggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctacagatgtttgggctgcgtcgccgtccgcagcctagcaagagcgccgtcattccg
gattacatgagggatctttaccggctccagtctggggaggaggaggaggaagagcagagc
cagggaactggacttgagtacccagagcgtcccgccagccgagccaacactgtgaggagt
ttccatcacgaagaacatctggagaacattccagggaccagtgagagctctgcttttcgt
ttcttcttcaacctcagcagcatccccgagaatgaggtgatctcctcggcagagctccgg
ctctttcgggagcaggtggaccagggccctgactgggaacaaggcttccaccgtataaac
atttatgaggttatgaagccccctgcagaaatggtgcctggacacctcatcacacgacta
ctggacaccagactggtccatcacaatgtgacacggtgggaaactttcgatgtgagccct
gcagtccttcgctggacccgggaaaagcaacccaattatgggttggccattgaggtgact
cacctccaccagacacggacccaccagggccaacatgtcagaatcagccgatccttacct
caagggagtggagattgggcccaactccggcccctcctggtcacttttggccatgatggc
cggggccataccttgacccgccagagggccaaacgtagtcccaagcatcacccacagcgg
tccaggaagaagaataagaactgccgtcgccattcactctacgtggacttcagtgatgtg
ggctggaatgattggattgtggccccaccgggctaccaggccttctactgccacggggac
tgtccctttccactggctgatcacctcaactcaaccaaccatgccattgtgcagacccta
gtcaactctgttaattctagcatccctaaggcctgttgcgtccccactgaactgagtgcc
atttccatgttgtacctggatgagtatgacaaggtggtgttgaaaaattatcaggagatg
gtggtagaggggtgcggatgccgctga

KEGG   Mus pahari (shrew mouse): 110327048
Entry
110327048         CDS       T05929                                 

Gene name
Amh
Definition
(RefSeq) muellerian-inhibiting factor
  KO
K04665  anti-mullerian hormone
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110327048 (Amh)
   04390 Hippo signaling pathway
    110327048 (Amh)
   04024 cAMP signaling pathway
    110327048 (Amh)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110327048 (Amh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110327048 (Amh)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110327048 (Amh)
SSDB
Motif
Pfam: AMH_N TGF_beta
Other DBs
NCBI-GeneID: 110327048
NCBI-ProteinID: XP_021061401
Ensembl: MGP_PahariEiJ_G0031016
LinkDB
Position
9
AA seq 555 aa
MQGPHFSPLALLLATMGAVLQAEAVEELATNTRGLIFLEDGLWPPSIPPEPLCLVTVRGE
GNTSRASLRVVGGLDSYEHAFLEAVQESRWGPQDLATFGVCSTDSQATLPALQRLGVWLG
ETGEQQLLVLHLAEVIWEPELLLKFQEPPPGGASRWEQALLVLYPGPGPQVTVTGTGLQG
TQNLCPTRDTRYLVLTVDFPAGAWSGSGLALTLQPSREGATLSTAQLQALLFGSDSRCFT
RMTPTLVLLPPAEQSPQPAHGQLDTMPFPQPGLSLEPEALSHSTDPFLETLTRLVRALRG
PLTRASNTHLALDPGALASFPQGLVNLSDPAALGRLLDGEEPLLLLLSSPAAATEREPMP
LHGPASAPWAAGLARRVAVELQAAASELRDLPGLPPTAPPLLSRLLALCPNDSRSSGDPL
RALLLLKALQGLRAEWRGREGRGRAGRSAGTGTDGPCALRELSVDLRAERSVLIPETYQA
NNCQGACAWPQSDRNPRYGNHVVLLLKMQARGVALGRLPCCVPTAYAGKLLISLSEERIS
AHHVPNMVATECGCR
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgcaggggccacacttctctccactggcactgctgctagcgactatgggggctgtgtta
caggctgaggcggttgaagagctggccaccaataccaggggcctcatcttccttgaagat
gggctctggccccccagcatcccccctgagcctttgtgcctggtgacagtgagaggagag
gggaacacaagcagagcttccctgagggtggtggggggtctggacagctatgagcatgcc
ttcctggaggctgtccaggagtctcgctggggaccccaagacctggccacctttggagtc
tgcagcactgactcccaggctaccctgcctgccctgcagcgccttggggtctggctaggg
gaaactggagaacagcagttgctagtcttacatctggctgaagtgatatgggagcctgag
ctcttgctgaagttccaagaacctccacctgggggagccagccgctgggagcaggccctg
ttagtgctataccctggaccaggcccccaggtcacagtcacagggactggactgcagggc
acacagaacctctgccctactcgggacacccgctatttggtgctgactgtggacttccca
gcgggggcctggagcggctcgggcctcgccctaacccttcaaccaagcagagaaggtgcc
accctaagcaccgctcagctgcaggcccttctgtttggctctgattcccgctgcttcacg
cgaatgactcccaccctggtgctgctgccacccgccgagcagtcaccgcagccagcacac
ggccagctggacaccatgcctttcccgcagcccgggctgtccctggagcctgaggctctg
tcacacagcaccgaccccttcctagagaccctcactcgcttggtccgtgctctgcgggga
cctctgacccgagcctcgaacacccatctggcactggaccctggtgcgctggccagcttc
ccacagggcctggtcaacctgtcagaccccgcagcactgggacgtctgctcgatggggag
gaacccctattactgctgctgtcatcacccgctgcggccacagagagggaacctatgcct
ctgcacggccccgcttctgctccctgggcagcgggcctggcacgcagggtagcggtggag
ctgcaggcggcagcctcggagctgcgggacctcccgggcctgccacccacagctcccccg
ctgctgtcacgcctgctggcgctgtgccccaacgactcccgcagctctggggaccctctg
cgcgcgctgctgctgctaaaggcgctgcaaggcttgcgtgccgagtggcgtgggcgggaa
gggcgtgggagggcggggcgcagcgcggggacagggacagacgggccttgtgcgctacgc
gagctgagtgtagatctgcgcgccgagcgttcggtgctcatcccagagacctaccaagcc
aacaactgccaaggcgcctgcgcgtggccgcagtctgaccgtaacccgcgctatgggaac
cacgtggtgctgctgctaaaaatgcaggctcgcggggtcgccctgggccgcctgccctgc
tgcgtgcccactgcctacgcgggcaagctgctcatcagtctgtccgaggagcgcatcagc
gcgcaccacgtgcccaacatggtagccaccgagtgcggctgccggtga

KEGG   Mus pahari (shrew mouse): 110327432
Entry
110327432         CDS       T05929                                 

Gene name
Bmp5
Definition
(RefSeq) bone morphogenetic protein 5 isoform X1
  KO
K04663  bone morphogenetic protein 5
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110327432 (Bmp5)
   04390 Hippo signaling pathway
    110327432 (Bmp5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110327432 (Bmp5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110327432 (Bmp5)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110327432 (Bmp5)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110327432
NCBI-ProteinID: XP_021062074
Ensembl: MGP_PahariEiJ_G0015312
LinkDB
Position
10
AA seq 452 aa
MHWTVILLRGIVGFLWSGWAQVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
LPHRPRPFSPGKQASSAPLFMLDLYNAMASEENPEESEYLVRVSLAGEAKETRKGYPASP
NAHRLHLPPRTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRF
DLTQIPHGEAVTAAEFRIYKDKGNHRFENETIKISIYQIIKEYTNRDADLFLLDTRKTQA
LDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRHGPQSKQPFMV
AFFKASEVLLRSVRAASKRKNQNRNKSNSHQDPSRMPSAGDYNTSEQKQACKKHELYVSF
RDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPT
KLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcattggactgtaattttacttaggggtattgtgggcttcctctggagcggctgggct
caagtgggttatgcaaaaggaggcttgggagacaatcacgtccactccagttttatttat
agaagactacggaaccatgaaagacgggaaatacagagggaaattctctctattttgggt
ttgcctcacagacccagacctttttcaccagggaaacaagcatcttctgcacccctcttt
atgctggatctgtacaatgccatggctagcgaagaaaatcctgaggagtcggaatatttg
gtgagggtgtccctggctggagaagccaaagagacaagaaagggatacccagcctctccc
aatgcgcatcgtctgcacttacctccaaggactcctctgactacccagagcccacctctt
gccagcctacatgataccaactttctgaatgatgctgacatggtcatgagctttgtcaac
ttagttgaaagagacaaggacttttctcatcagagaaggcattacaaagagtttcggttt
gatctgacccagattccacatggagaagcagtgacagcagccgaattccggatttacaag
gacaagggcaaccatcgatttgaaaatgaaacaattaagatcagcatatatcagatcatc
aaggaatacacaaatagggatgcagacctttttctgctagatacaaggaagacacaagct
ttagatgtgggttggcttgtctttgatatcactgtgaccagcaatcattgggtgattaat
ccacagaacaatttgggcttacagctctgtgcagagacgggggatggacgcagcatcaat
gtaaaatctgctggtcttgtgggaagacatggacctcagtcaaaacagccgttcatggtg
gccttcttcaaggccagtgaggtacttcttcgatctgtgagagcagccagcaaacggaaa
aatcaaaaccgcaataaatccaactctcatcaggacccctccaggatgcccagtgctgga
gattataataccagtgaacaaaaacaagcctgtaagaagcacgaactctatgtgagtttc
cgagatctgggttggcaggactggatcatagcaccggaagggtatgctgcattttattgc
gatggagaatgttcttttccacttaatgcccatatgaatgccaccaaccatgccatagtc
cagaccctggtacacctgatgtttcctgaccatgttcccaagccttgctgtgctccaacc
aaactaaatgccatctcggtcctgtactttgatgacagctccaatgtaattttgaaaaag
tacagaaatatggtagtacgttcgtgtggctgccactag

KEGG   Mus pahari (shrew mouse): 110333720
Entry
110333720         CDS       T05929                                 

Gene name
Bmp6
Definition
(RefSeq) bone morphogenetic protein 6 isoform X1
  KO
K16620  bone morphogenetic protein 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110333720 (Bmp6)
   04390 Hippo signaling pathway
    110333720 (Bmp6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110333720 (Bmp6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    110333720 (Bmp6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110333720 (Bmp6)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110333720 (Bmp6)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110333720
NCBI-ProteinID: XP_021071052
Ensembl: MGP_PahariEiJ_G0019510
LinkDB
Position
16
AA seq 507 aa
MPGLGRRAQWLCWWWGLLCSCGPPPLRPPLPVAAAAAGGQLLGAGGSPVRAEQPPPQSST
SGFLYRRLKTHEKREMQKEILSVLGLPHRPRPLHGLQQPQPPVLPPQQQQQQQTAREEPP
PGRLKSAPLFMLDLYNALSNDDEEDGASEGEGQEPGSHGGASSSQLRQPSPGAAHSLNRK
SLLAPGPGGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIP
EGEAVTAAEFRVYKDCVVGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWL
EFDITATSNLWVVTPQHNMGLQLSVVTRDGLHVNPRAAGLVGRDGPYDKQPFMVAFFKVS
EVHVRTTRSASSRRRQQSRNRSTQSQDVSRGSGSSDYNGSELKTACKKHELYVSFQDLGW
QDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAI
SVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgcccgggctggggcggagggcgcagtggctgtgctggtggtgggggttgctgtgcagc
tgcggccccccgccactgcggccccctctgccggtagccgcggccgccgccggggggcag
ctgctgggagccggcgggagcccggtgcgcgccgagcagccaccgccacagtcctctact
tcgggcttcctctatcggcggctcaagacccacgagaagcgggagatgcaaaaggagatc
ctgtcggtgctggggctccctcacaggccgcggcccctgcacggtctccagcagcctcag
cccccagtgctcccgccacagcagcagcagcagcagcagacggcccgcgaggagccccct
ccagggcggctgaagtccgctccgctcttcatgctggatctctacaacgccctgtccaat
gacgacgaagaggatggggcatcggagggtgaggggcaggagcctgggtcccacggaggt
gccagctcgtcccagctcagacagccgtctcccggcgctgcacactccttgaaccgcaag
agcctcctggccccgggacccggtggcggtgcgtccccactgaccagcgcgcaggacagc
gctttcctcaacgatgcggacatggtcatgagctttgtgaacctggtggagtacgacaag
gagttctccccacgtcagcgacaccacaaagagttcaagttcaacctatcccagattccc
gagggtgaggcggtgacggctgctgagttccgcgtctacaaggactgtgtggtggggagt
tttaaaaaccaaacctttcttatcagcatttaccaagtcttgcaggagcatcagcacaga
gactctgacctatttttgttggacacccgggtggtgtgggcctcagaagaaggctggctg
gaatttgacatcacagcaactagcaatctgtgggtggtgacaccgcagcacaacatggga
ctccagctgagtgtggtgactcgggatggactccacgtcaacccccgtgcggcgggcctg
gtgggcagagacggcccatacgacaagcagcccttcatggtggccttcttcaaggtgagc
gaggtccacgtgcgcaccaccaggtcagcctccagtcggcggcggcagcagagtcgcaac
cggtccacccagtcgcaggacgtgtcccggggctccggttcttcagactacaatggcagt
gagttaaaaacagcctgcaagaagcatgagctttatgtgagcttccaggacctgggatgg
caggactggatcattgcacccaaaggctatgctgccaactactgtgatggagagtgttcc
ttcccactcaacgcacacatgaatgccaccaaccacgccattgtacagaccttggtccac
cttatgaatcccgagtacgtccccaaaccatgctgcgcaccaaccaagctgaatgccatc
tcggttctttacttcgacgataactccaatgtcatcttgaaaaagtacaggaatatggtc
gtgagagcttgtggttgccattaa

KEGG   Mus pahari (shrew mouse): 110338911
Entry
110338911         CDS       T05929                                 

Gene name
Gdf6
Definition
(RefSeq) growth/differentiation factor 6
  KO
K20012  growth differentiation factor 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110338911 (Gdf6)
   04390 Hippo signaling pathway
    110338911 (Gdf6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110338911 (Gdf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110338911 (Gdf6)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110338911 (Gdf6)
SSDB
Motif
Pfam: TGF_beta TGFb_propeptide
Other DBs
NCBI-GeneID: 110338911
NCBI-ProteinID: XP_021078038
Ensembl: MGP_PahariEiJ_G0023923
LinkDB
Position
22
AA seq 453 aa
MDTPRVLLWAIFLISFLWDLPGFQQASISSSSSSTELDSTKDVEDRKEGKMQRTPQESAE
GRTPQEHRLRQKELRRRPPGQPQGQEPPGRGPRVVPHEYMLSIYKTYSIAEKLGINASFF
QSSKSANTITSFVDRGLDDLSHTPLRRQKYLFDVSTLSDKEELVGAELRLYRQAPPTPWG
LPARPLHLQLFPCLSPLLLDARTLDPQGPAQAGWEVFDVWQGLRPQPWKQLCLELRAAWG
ELDAGDTEARAKGPQQPPPLDLRSLGFGRRVRPPQERALLVVFTRSQRKNLFTEMHEQLG
STEAAGAEGSWPAPSGSPDAGSWLPSPGRRRRRTAFASRHGKRHGKKSRLRCSRKPLHVN
FKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVP
TKLTPISILYIDAGNNVVYKQYEDMVVESCGCR
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggacactcctagggtccttctctgggcgatcttcctcatcagcttcctctgggatttg
ccgggtttccagcaggcttccatctcctcgtcctcctcctccaccgaattggactccacc
aaagacgtggaggaccgcaaagaagggaagatgcagaggactccacaagagagtgccgag
ggccggacgccccaggaacaccggctgcggcagaaggagctccggcggcggccgcctgga
caacctcaagggcaggagccgccgggcagggggccgcgcgtggttcctcacgagtacatg
ctgtcaatctacaagacttactccattgccgagaagctgggcatcaatgccagctttttc
cagtcttccaagtcagctaatacgatcactagctttgtagacagaggactggacgatctc
tcgcacactcctctccggagacagaagtatttgtttgatgtgtccacgctctcagacaaa
gaagagctggtgggcgcagagctgaggctttatcgccaggcgcccccaacgccctggggg
ctaccggcccgaccgctgcacttgcagctcttcccttgtttatccccattgctactggac
gccaggaccctggatcctcagggaccagcccaggccggctgggaagtcttcgacgtgtgg
cagggcctgcgtcctcagccgtggaagcagctgtgcttggagttgcgggcagcctggggt
gagctggacgccggggatacggaggcgcgcgcgaagggtccccagcagccaccgcctctg
gacctgcggagtctgggcttcggccggagggtgcggccgccccaggagcgcgccctgctt
gtagtgttcaccagatcgcagcgcaagaacctgttcactgagatgcatgagcagctgggc
tctacagaggctgcaggagccgaggggtcatggccagcgccgtcgggctccccagacgcc
gggtcttggctgccctcgcccggccgccggcggcgacgcaccgccttcgccagccgtcac
ggcaagcgacacggcaagaagtccaggctgcgctgcagcagaaagcctctgcacgtgaat
tttaaggagttaggctgggacgactggattatcgcgcccctagagtacgaggcctatcac
tgcgagggcgtgtgcgactttccgctgcgctcgcacctggagcccactaaccacgccatc
atccagacgctgatgaactccatggacccgggctccaccccacctagctgctgcgttccc
accaaattgactcccatcagcatcctgtatatcgacgcgggcaataatgtagtctacaag
cagtacgaggacatggtggtggagtcctgcggctgtaggtag

DBGET integrated database retrieval system