KEGG   Mus pahari (shrew mouse): 110318307Help
Entry
110318307         CDS       T05929                                 

Gene name
Metap1d
Definition
(RefSeq) methionine aminopeptidase 1D, mitochondrial
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
mpah  Mus pahari (shrew mouse)
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mpah01002]
    110318307 (Metap1d)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     110318307 (Metap1d)
Peptidases [BR:mpah01002]
 Metallo Peptidases
  Family M24
   110318307 (Metap1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 110318307
NCBI-ProteinID: XP_021048913
Ensembl: MGP_PahariEiJ_G0025097
LinkDB All DBs
Position
3
AA seq 335 aa AA seqDB search
MAAPIGVLLLIRGGCQRILSSPLNPIYLHKRSGSQQRRHFFFWRQRDISHSVVSPAAVSP
AHPVPKHIKKPDYVTTGIVPDWGDSIEVKNEDQIQGLREACQLARHVLLLAGKSLKVDMT
TEEIDALVHREIIRHDAYPSPLGYGRFPKSVCTSVNNVLCHGIPDSRPLQDGDIINIDVT
VYYNGYHGDTSETFLVGNVDESGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISRITHQ
NGLQVCPHFVGHGIGSYFHGHPEIWHHANDNDLLMEEGMTFTIEPIITEGSPEFKVLEDA
WTVVSIDNQRSAQFEHTVLITPRGVEILTKLPQEA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcccatcggcgtcctcctgctcatccgtggaggttgtcagagaattctgtct
tcgccactcaatcctatctacttacacaagcggtcaggcagtcaacaaagaagacatttc
tttttctggagacaaagggatatctcccacagtgtggtttccccggctgccgtctctccc
gcacatcctgtccccaagcatataaagaagccagactatgtgacgacaggcattgtgccg
gactggggagacagcatagaagtgaagaatgaggatcagattcaagggcttcgtgaggct
tgtcagctggcgcggcacgtcctcctcctggctgggaagagtttaaaggttgacatgaca
actgaagagatagatgcacttgttcatcgggaaatcatcaggcatgacgcatatccctca
cctctgggctatggacgctttccaaaatctgtttgcacctctgtaaacaatgtgctctgt
catggcattcctgacagccgacctcttcaggatggagatattatcaacattgatgtcacg
gtctattacaatggctaccatggagacacctctgaaacctttctggtgggcaatgtggat
gaaagtggtaaaaagttagtggaggttgccaggaggtgtagagatgaagcaattgcagcc
tgcagagctggggcccccttctctgtaattggaaacacaatcagccgaataactcatcag
aatggtttgcaagtctgtccacattttgtaggacatgggataggatcgtactttcatgga
cacccagaaatttggcatcatgcaaatgacaatgatctgctcatggaggagggcatgact
ttcaccatagagccaatcatcactgaaggctccccagaatttaaagtccttgaggacgca
tggactgtggtctcgatagacaaccaaaggtctgcgcagttcgagcacacagtcctcatc
acgccaaggggagtggagatactaaccaaactgccacaagaagcctga

DBGET integrated database retrieval system