KEGG   Mus pahari (shrew mouse): 110318424
Entry
110318424         CDS       T05929                                 

Gene name
Crb2
Definition
(RefSeq) protein crumbs homolog 2
  KO
K16681  protein crumbs
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110318424 (Crb2)
SSDB
Motif
Pfam: EGF hEGF Laminin_G_2 EGF_CA Laminin_G_1 EGF_2 cEGF
Other DBs
NCBI-GeneID: 110318424
NCBI-ProteinID: XP_021049132
Ensembl: MGP_PahariEiJ_G0024975
LinkDB
Position
3
AA seq 1282 aa
MALVEPGIWGTRRDVYPLLLLLLLLLLLLPWVPAGLVPSETPSVCASDLCAPGTKCQATE
SGGYTCEPSELGGCATQPCHHGALCVPQGPDPNSFRCYCVPGFQGPHCELDIDECASRPC
QHGGTCRNLADHYECHCPLGYAGVTCEAEVDECSSAPCLHGGSCLDGVGSYRCVCAPGYA
GANCQLDVDECQSQPCAHGGVCHDLVNGFRCDCEDTGYEGAHCEQEVLECASAPCAHNAS
CLDGFRSFRCLCWPGFSGERCEVDEDECASDPCHNGGRCLQRSDPTLYGGVQAIFPGAFS
FSHAAGFLCSCPLGFAGNDCSVDVDECASGPCLNGGSCQDLPNGFQCYCQDGYTGLTCQE
DMDECQSEPCLHGGTCSDTVAGYICQCPEAWGGHDCSVQLTGCQGHTCPLAATCIPTFKS
GLHGYFCRCPPGTYGPFCGQNTTFSVVSGSSVWGLVPVGASLGLALRFRTTLLAGTLATL
RDTQDSLELVLVGAVLRATLSRHGTAVLILTLPDLALNDGHWHQVEVAFRLGTLELRLWH
EACPGQLCVASGPVATGPTASVAPGSPGPYSIHLGGGAFAGCFQDVHVEGHLLLPEELNG
TVLLGCEYREPCLPLPCAHGGACVDLWTHFRCDCPRPYRGATCTDEVPAATFGLGGVTSS
ASFLLHQLLGPNLTVSFFLRTREPVGLLLQFTNDSVVSLSVSLSEGQIRAEGLGHPAVIL
PGRWDDGLPHLVTLSFGPDQLQDLGQRLYVGGRFYPDDTQPWGGPFRGCLQDLQLNGIHL
SFFSSPMENSSWPSESEAGQSSNLTQGCVSEDMCNPNPCFNGGTCHVTWNDFYCTCSDNF
TGPTCAQQRWCPRQPCLPPATCEEVPDGFVCVAEATFREGPPAVFTGHNVSSSLSGLTLV
FRTRDPEAGLLRAASAAGAHSNIWLAVRNGSLAVDVAGSVLPAPGPSVADGAWHRVRLAR
EFPQAAASRWLLWLDGAATPVALHGLGGDLGFLQGPGAVPLLLAENFTGCLGRVALGDLP
LPLAPPRSGAVSGAREHFVAWPGSPAVSLGCRGGPVCSPSPCLHGGACRDLFDVFACSCG
PAWEGPRCEVHVDSCRSSPCVRGQCHARPDGRFECRCPLGFSGPRCRLPVLPQGCSLNST
CKDGAPCEGGPLGTNCSCQEGLAGFRCQSLDQPCEASPCLNGGTCRVASGIFECTCSAGF
SGQFCEVVKTLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQ
EVAGARLEMDSVLKVPPEERLI
NT seq 3849 nt   +upstreamnt  +downstreamnt
atggcgctggtggagcctgggatctggggcactagacgagatgtctaccccctgttgctg
ctactgctactgctgctgctgctgctgccctgggtcccggctgggttggttccttcagag
actccaagtgtctgtgcctcagacctgtgtgctccagggaccaagtgccaggctacagaa
agtggtggctatacctgtgagccctcagagcttggaggctgtgctactcaaccatgccac
cacggtgcactgtgtgtgccccagggcccagatcctaacagcttccgttgctactgtgtg
cctggattccagggaccccactgtgaactggacatcgatgagtgtgcatcccggccttgc
cagcatgggggcacctgccgaaatctggcggatcactatgagtgccactgtcccctggga
tatgcaggcgtgacctgcgaggccgaggtggacgagtgctcgtcagcgccctgcctgcac
ggaggctcgtgcctggacggtgtgggttcctaccgctgcgtgtgcgcaccgggatacgct
ggtgcgaactgccagctagacgtggacgagtgccagagccagccgtgcgcgcacggtggc
gtgtgtcacgacctggtcaacggtttccggtgcgactgcgaggacacgggttatgaaggc
gcgcactgtgagcaggaggtgctggagtgcgcctctgcgccctgcgcgcacaacgcgtcc
tgcctcgatggcttccggagcttccgctgcctttgctggccaggcttcagtggagagcgg
tgtgaagtggatgaggatgaatgtgcatcagacccctgtcataatgggggccggtgcttg
caacgctctgacccgaccttgtacgggggtgttcaggccatcttcccgggagccttcagc
ttcagccacgctgctggcttcctttgcagctgtcctctgggctttgccgggaatgactgc
agcgtggatgtggatgagtgtgcctcagggccgtgcctcaacggaggtagttgccaggac
ctgcccaatggtttccagtgctactgccaggatggatacacaggcctgacatgtcaggaa
gatatggacgaatgccagtcagaaccatgcctgcatggtggaacctgcagtgacactgta
gcaggctacatctgccagtgccccgaggcctggggtggacatgactgttctgtgcagctc
acaggctgccagggccacacctgcccactggctgccacctgcatccccaccttcaagtct
ggcctccacggttacttctgccgctgcccaccagggacctatgggcctttctgtggccag
aatacgaccttctcggttgtgtctgggagttctgtgtggggattggtgccagttggtgcc
tccctgggtctggcactgagatttcgtaccacgctgcttgccggaaccctggctactctg
agggacactcaggacagcttggagctggttctggtgggggctgtgctccgagccacactc
tcgagacatggcactgccgtgctcatccttacactgcctgacctagccttaaatgacggg
cattggcaccaggtagaagtggcgttccgcctgggaaccctggagctgcggctctggcac
gaggcctgccccggccagctctgtgtagcctctggtcctgtggctacaggtcctacagcc
tcggtggcccctgggtctccggggccctactccatccatctgggcggtggggcctttgcc
ggctgcttccaggatgtgcatgtggaagggcaccttctgctgccggaggagctcaatgga
accgtgcttctgggttgtgagtacagggaaccttgcctgcctctgccctgtgcccacgga
ggggcctgtgtggacctgtggactcacttccgctgcgactgcccgagaccttaccgtgga
gccacatgcactgatgaggttcctgctgccacctttggcttgggtggcgtcacgagctca
gcctctttcctgctccaccagctgctaggcccaaacctcaccgtgtcctttttcctccgc
acccgcgagcctgtgggcctgttgctccagtttaccaatgactcagttgtgagcctgtct
gtgtccctgagtgagggccagatccgggctgagggactgggtcatcctgctgtgatcctc
cctgggcgctgggatgatggactcccccacttggtgacgctcagctttgggcctgaccag
ctgcaggacctgggccagcggctgtatgtgggcgggaggttctaccctgatgacacccag
ccctggggtgggcccttccgaggctgtctccaggacttacaactcaacggcatccacctc
tccttcttctcttccccgatggagaactcaagttggcccagtgaatcggaagctggtcag
tcctccaacctcacccagggctgtgtctctgaggacatgtgcaatcccaatccctgtttc
aatggtggcacgtgccacgtcacctggaatgacttctactgtacctgctcggacaacttc
acggggcccacctgtgcccagcagcgatggtgccccaggcagccatgcctgccgcctgcc
acctgtgaggaggttccagatggctttgtgtgtgtggccgaggccacgttccgtgagggc
cctcctgctgtgttcacaggccacaacgtgtcctcgtcactcagcgggctcaccctggtc
ttccgcacgcgcgaccccgaggctgggctactgcgcgcagcttccgccgcaggtgcccac
tccaatatctggctggcggtgcgcaacggctcgctggcagtagatgtggcgggttcggtg
ctgcccgcgcccgggccgagcgtggccgacggcgcctggcatcgcgtgcgcctagcccgg
gagttcccacaggccgctgcctcacgctggctgctgtggctggacggcgcggcgacaccc
gtggctttgcacggcttgggcggcgacctgggcttcctgcagggcccgggtgcagtgcct
ctgctactggctgagaacttcacgggctgcctgggccgcgtggcgctcggcgacctcccg
ttacccttggcgccaccgcggtccggcgcggtgtctggggcgcgcgagcacttcgtggcc
tggcccgggtctccggccgtgagcctcggctgccgtggcggacccgtatgctcaccctcg
ccctgcctgcacggtggcgcctgccgcgacctcttcgatgtcttcgcttgctcctgcggc
cccgcctgggaaggaccccgctgcgaggtccacgttgactcatgtcgctcctctccctgt
gtccggggccaatgccacgcgcgccccgacggccgcttcgagtgtcgctgccctctgggc
ttctccggcccgcgctgcaggttgcctgtcctgcctcagggatgcagcctcaactccacc
tgcaaggatggcgccccttgtgaaggtggccccttaggcaccaactgcagttgccaggaa
ggccttgctggcttcagatgtcagagtctcgaccaaccctgtgaagccagcccttgcttg
aatgggggcacctgccgggtggccagtggcatatttgaatgtacttgcagcgcaggattc
tctggccagttctgtgaagtggtgaaaaccctgcctctgcctctgccgttcccactgctg
gaggtagcagtgcctgcagcctgtgcctgccttctccttcttctcctgggcctcctctca
ggaatcctggctgccagaaagcgccgacagtctgagggcacttacagcccaagtcagcag
gaggtggctggggctcgtctggagatggacagtgtcctcaaggtgccaccagaggagaga
cttatctag

KEGG   Mus pahari (shrew mouse): 110321774
Entry
110321774         CDS       T05929                                 

Gene name
Crb1
Definition
(RefSeq) protein crumbs homolog 1 isoform X1
  KO
K16681  protein crumbs
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110321774 (Crb1)
SSDB
Motif
Pfam: EGF hEGF Laminin_G_2 Laminin_G_1 EGF_CA EGF_3 cEGF EGF_2 SH3_6
Other DBs
NCBI-GeneID: 110321774
NCBI-ProteinID: XP_021053908
Ensembl: MGP_PahariEiJ_G0027902
LinkDB
Position
5
AA seq 1405 aa
MKLKTTASLLFLYLSSSLLICIKNSFCNKNNIRCLSDSCQNNSTCKRSPQDNNCCLDTAS
DLDKDCEDLKDPCFSSPCQGIATCVNIPGEGRFLCQCPPGYSGLTCETATNSCGGSLCQH
GGTCHKDPEQPVCMCPPGYAGRFCETDHNECASSPCHNGAMCQDEINGYSCFCVPGYQGR
HCDLEVDECVSDPCKNEAVCLNEIGRYTCVCPQAYSGVNCELEMDECRSQPCLHGATCQD
APGGYSCDCAPGFLGDHCELNVNECESQPCLHGGLCVDGRNSYHCDCTGSGFTGMHCESL
IPLCWSKPCHNNATCEDTIDSYICHCWPGYTGALCEADINECSSNPCQFGGQCVELSSED
LYGNTAGLPSSFSYVGASGYVCICLPGFTGIHCEEDIDECLPNPCLNGGTCENLPGNYTC
HCPFDDTSRTFYGGEDCSEILLGCTHHQCLNNGKCVPHFQNGQHGFTCQCPSGYAGPLCE
TVTTLSFGSNGFLWVTSDSHIGIGSECNISLRFQTVQTNALLLIRGNKDMSMKLELLNGC
VHLSVEVWKQSKVLLYISHNTSDGEWHFVEVTIAETLTLALVGRSCKEKCTTKSSIPVEN
YQSICALQNSFLGGLPMGTTSNSVSVLNIYNVPSIPSFVGCLQDIRFDLNHITLENVSSG
LSSNVKAGCLGKDWCESQPCQNRGRCINLWQGYQCECDRPYTGSNCLKEYVAGRFGQDDS
IGYAAFSVNDNYGQNFSLSMFVRTHQPLGLLLALENRTYQYVCVWLEHGRLALQTPGSPK
FVVNFFLSDGNAHLISLRIKPNEIELYQSSQNLGFISVPAWTIQRGDVIFIGGLPDREKT
EGYGGFFKGCVQDVRLNNQNLEFFPNSTNNAYHDPILVNVTQGCPGDNICKSNPCHNGGV
CHSLWDDFSCSCPTNTAGRACEQVQWCQLSPCPPIAECQLLPQGFECIANAVFSGLSREI
LFRSNGNITRELTNITFGFRTHDTNVMILHAEKEPEFLNISIQDARLLFQLRSGNSFYTL
HLMSSQLVNDGTWHQVTFSMIDPVAQTSRWQMEVDDQTPFVISAVATGSLNFLKDNTDIY
VGDQAVDNLKGLQGCLSTIEIGGIYLSYFENLHGYPSKPQEEQFLKVSTNMVLTGCLPSN
ACHSSPCLHGGNCEDGYSSYRCACLSGWSGTHCEINIDECFSSPCIHGNCSDGVAAYHCS
CEPGYTGVNCEADVDNCKSHQCANGATCVPEAHGYSCLCFGNFTGRFCRHSRLPSTVCGN
EKTNFTCYNGGSCSVFQEDWKCMCWPGFTGEWCEEDINECASDPCINGGLCRDLVNRFLC
ICDVAFAGERCELDLTDDRLLGIFTAVGSGTLALFFILLLAAVASLIASNKRATQGAYSP
SGQEKAGSRVEMWIRMPPPTLERLI
NT seq 4218 nt   +upstreamnt  +downstreamnt
atgaagctcaagacaactgcctcccttctcttcttgtacctcagttcctcactgctcatc
tgcataaagaattcattttgcaataaaaacaatatcaggtgtctctcagattcttgccaa
aacaattctacatgtaagcgttctccacaagacaacaactgttgcttagatacagccagt
gatctggacaaagactgtgaagatctgaaagacccttgcttctccagtccctgccaagga
attgccacttgtgtaaatattccaggggaagggagattcctatgtcagtgtcctcctggg
tatagcgggctgacctgtgaaactgccaccaattcctgtggagggagcctctgccaacat
ggaggcacctgccataaagaccctgagcagcctgtctgtatgtgccctcctggatatgct
ggaaggttctgtgagactgatcacaatgaatgtgcttctagcccttgccacaatggggct
atgtgccaggatgaaatcaatggctactcctgcttctgtgtgcctggataccaaggcagg
cactgtgacttggaagtggatgaatgtgtttctgatccctgcaagaatgaggctgtgtgc
ctcaatgagataggaagatatacttgtgtctgtcctcaagcatattctggcgtgaactgt
gagttggaaatggatgaatgcagatcccagccgtgtctccacggtgccacgtgtcaggat
gctcctgggggttactcctgtgactgtgcacctggattccttggagaccactgtgaactc
aatgttaatgaatgtgaaagtcagccatgtctccatggaggtctatgcgtagatggaaga
aacagttaccactgtgactgcacaggtagtggattcacagggatgcactgtgagtccttg
attcctctttgttggtcaaagccttgtcacaacaatgcgacatgtgaagacactattgac
agctatatttgtcactgctggcctggctacacaggtgccctgtgtgaggcggacataaat
gaatgcagtagcaacccctgccaatttggggggcagtgtgttgagctgtcctcagaggat
ctatatggaaacactgctggcctgccttcctccttcagctacgttggagcctcgggctat
gtatgtatctgtctgcccggattcacaggaatccactgtgaagaagacattgatgaatgt
ttaccgaatccttgcctaaatggtggtacttgtgagaacctgcctgggaattatacctgt
cactgtccctttgatgatacttctaggacattttatggaggagaagactgctctgaaatt
ctcctgggttgcactcatcaccagtgtctgaacaatggaaaatgtgtccctcatttccaa
aatggccagcatggattcacttgccagtgtccttctggctatgctggaccactgtgtgaa
actgtcaccacactttcatttggtagcaatggcttcttgtgggtcacaagtgactcccat
ataggcatagggtcagaatgtaacatatccttgaggtttcagactgttcagacaaatgca
cttcttctcatccgaggcaacaaggatatgtctatgaagctggagttgttgaatggttgt
gttcatttatcagtcgaagtctggaagcagtcaaaggtgctcctgtatatttctcataac
accagtgatggagaatggcatttcgtggaggtaacaattgcagaaactctaacccttgcc
ctagttggcagatcctgcaaggagaagtgcaccaccaagtcttctattccagttgagaat
tatcaatcaatatgtgctttgcagaactcttttttgggtggcttaccaatggggacaacc
agcaacagtgtgtctgtgcttaacatctataatgtgccatccataccttcctttgtaggc
tgtctccaagatattaggtttgatttgaatcacattactctggagaacgtttcatctggc
ctgtcatcaaatgttaaagcaggctgcctgggaaaggactggtgtgaaagtcaaccctgt
caaaacagaggacgctgcatcaacttgtggcagggttatcagtgtgaatgtgacaggccc
tatacaggctccaactgcctgaaagagtatgtagcaggaagatttggccaagatgactcc
atcggatatgcggcctttagtgttaatgataattatgggcagaacttcagtctctcaatg
tttgtccgaacacatcaacccttgggcttacttctggctttggaaaaccgtacttaccag
tatgtctgtgtctggctagagcacggccgcctagcactgcagactccaggctcccccaag
ttcgtggtaaatttttttcttagtgatggaaatgcccacttaatatctttgagaatcaaa
ccaaatgaaattgaactgtatcagtcttcacaaaacctaggattcatttctgttcctgca
tggacaattcaaagaggagatgtcatcttcattggtggcctacctgacagagagaagact
gaaggttatggtggcttcttcaaaggctgtgttcaagatgtcagattaaacaaccagaat
ctggaattctttcccaattcaacaaacaatgcataccatgacccaattcttgtcaatgtg
actcaaggctgtcccggagacaacatatgtaagtccaacccctgtcataatggaggtgtc
tgccattccctgtgggatgacttctcctgctcctgccctacaaacacggcggggagagcc
tgcgagcaagttcagtggtgtcaactcagcccatgtcctcccattgcagagtgccagctg
ctccctcaagggtttgaatgtattgcaaatgctgttttcagcggattaagcagagaaata
ttgttcagaagcaatgggaatattaccagagaactcaccaatatcacatttggtttcaga
acacatgatacaaacgtgatgatattgcatgcagaaaaagaaccagagtttcttaatatt
agtattcaagacgccagattactctttcaattgcgaagtggcaacagcttttataccctg
catctgatgagttcccagttggtgaatgatggcacatggcaccaagtgactttttccatg
atagacccagtggcccagacctcccggtggcaaatggaggtggacgaccagacacccttt
gtgataagtgcagttgctactggaagcctgaactttttgaaggacaatacagacatctat
gtgggtgaccaagctgttgacaatctgaaaggcctgcagggctgtctgagcacaatagag
attggaggcatatatctctcttactttgaaaatcttcatggttatcctagtaagccccag
gaagagcaatttctcaaagtttctacaaatatggtactgactggctgtttgccatcaaat
gcctgccactccagcccctgtttgcatggaggaaactgtgaagacggctacagttcttat
cggtgtgcctgtctctcgggatggtcagggacacactgtgaaatcaacattgatgagtgc
ttttctagcccctgtatccatggcaactgctctgatggagtggcagcctaccactgcagc
tgtgagcctggatacaccggtgtgaactgcgaggcggatgtagacaattgcaagagtcat
cagtgtgcaaatggggccacctgtgtccctgaagctcatggctactcttgcctctgcttt
ggaaattttaccgggagattttgcagacacagcagattaccctcaacagtctgtgggaat
gagaagacaaatttcacttgctacaatgggggcagctgctccgtgttccaggaggactgg
aaatgtatgtgctggccaggtttcactggagagtggtgtgaagaggacatcaacgagtgt
gcctccgatccctgcatcaatggaggactgtgccgggacttggtcaacaggttcctgtgc
atctgtgatgtggccttcgctggcgagcgctgtgagctggatctgactgatgacagactc
ctgggcattttcaccgccgttggctccggaactttggccctgttcttcatcctcttgctt
gctgcagttgcttctcttatcgcctccaacaaaagggcgactcaaggagcctacagcccc
agcggtcaggagaaagctggctctcgagtggaaatgtggatcaggatgccgcccccgaca
ctggaaaggctcatctag

DBGET integrated database retrieval system