KEGG   Mus pahari (shrew mouse): 110318630
Entry
110318630         CDS       T05929                                 

Gene name
Bcl2l1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01524  Platinum drug resistance
mpah04014  Ras signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04115  p53 signaling pathway
mpah04137  Mitophagy - animal
mpah04140  Autophagy - animal
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah05012  Parkinson disease
mpah05014  Amyotrophic lateral sclerosis
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05145  Toxoplasmosis
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05168  Herpes simplex virus 1 infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110318630 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    110318630 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    110318630 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    110318630 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110318630 (Bcl2l1)
   04137 Mitophagy - animal
    110318630 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    110318630 (Bcl2l1)
   04215 Apoptosis - multiple species
    110318630 (Bcl2l1)
   04115 p53 signaling pathway
    110318630 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110318630 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318630 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    110318630 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110318630 (Bcl2l1)
   05225 Hepatocellular carcinoma
    110318630 (Bcl2l1)
   05220 Chronic myeloid leukemia
    110318630 (Bcl2l1)
   05222 Small cell lung cancer
    110318630 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110318630 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    110318630 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    110318630 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110318630 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    110318630 (Bcl2l1)
   05162 Measles
    110318630 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    110318630 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110318630 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110318630 (Bcl2l1)
   01524 Platinum drug resistance
    110318630 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110318630 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110318630 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpah02000]
    110318630 (Bcl2l1)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110318630 (Bcl2l1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110318630 (Bcl2l1)
Transporters [BR:mpah02000]
 Other transporters
  Pores ion channels [TC:1]
   110318630 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110318630
NCBI-ProteinID: XP_021049467
Ensembl: MGP_PahariEiJ_G0025916
LinkDB
Position
3
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggaactggtggtcgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtcgaagagaataggactgaggccccagaagaa
actgaagcagaaagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gatagccccgcggtgaatggagccactggccacagcagcagtttggatgcgcgggaggtg
atccccatggcagcagtgaagcaagcgctgagagaggctggcgatgagtttgaactgcgg
taccggagagcgttcagtgatctaacatcccagcttcatataaccccagggaccgcgtat
cagagctttgagcaggtagtgaatgaactctttcgggatggagtaaactggggtcgcatc
gtggcctttttctcctttggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaagttggatggccacctatctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggatctctacgggaacaatgcagca
gcggagagtcggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctcactcttcagtcggaagtga

DBGET integrated database retrieval system