KEGG   Mus pahari (shrew mouse): 110318694
Entry
110318694         CDS       T05929                                 

Gene name
Spi1
Definition
(RefSeq) transcription factor PU.1 isoform X1
  KO
K09438  transcription factor PU.1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04380  Osteoclast differentiation
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110318694 (Spi1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110318694 (Spi1)
   05202 Transcriptional misregulation in cancer
    110318694 (Spi1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110318694 (Spi1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110318694 (Spi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110318694 (Spi1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110318694 (Spi1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 110318694
NCBI-ProteinID: XP_021049567
Ensembl: MGP_PahariEiJ_G0025389
LinkDB
Position
3
AA seq 271 aa
MLQACKMEGFPLVPPPSDELVTYDSELYQRQTHDYYSLMGSDGESHSDHYWDFPPHHVHS
EFENFSENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVPYMPRMCFP
YQSLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRLPPH
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctccatcggatgagctg
gttacttacgattcagaactataccaacgtcaaacgcatgactactactccttgatgggc
agcgatggagaaagccatagtgatcattactgggatttccccccacaccatgtccacagc
gagtttgagaacttctctgagaaccacttcacggagctgcagagcgtgcagcccccgcag
ttacagcagctctatcgccacatggagctggaacagatgcatgtcctcgatacccccatg
gtgccaccccacaccggcctcagtcaccaggttccctacatgccccggatgtgcttccct
tatcaatccttgtccccagcccaccagcagagctcagatgaggaggagggtgagaggcag
agccctcccctggaggtatctgatggagaagctgatggcttggagcctgggccaggtctt
ctgcacggggagacaggcagcaagaaaaagattcgcctgtaccagttcctgctggacctg
ctgcgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaaaggtaccttc
cagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaac
cgcaagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagacgggc
gaggtgaagaaagtcaagaagaagctcacctaccagttcagcggcgaggtgctgggccgc
gggggcctggccgagcggcgcctcccgccccactga

DBGET integrated database retrieval system