Mus pahari (shrew mouse): 110318967 Help Entry 110318967         CDS       T05929                                  Definition (RefSeq) GTPase HRas-like isoform X1   KO K02833   GTPase HRas Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04012   ErbB signaling pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04062   Chemokine signaling pathway mpah04068   FoxO signaling pathway mpah04071   Sphingolipid signaling pathway mpah04072   Phospholipase D signaling pathway mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah04144   Endocytosis mpah04150   mTOR signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04211   Longevity regulating pathway mpah04213   Longevity regulating pathway - multiple species mpah04218   Cellular senescence mpah04360   Axon guidance mpah04370   VEGF signaling pathway mpah04371   Apelin signaling pathway mpah04510   Focal adhesion mpah04540   Gap junction mpah04550   Signaling pathways regulating pluripotency of stem cells mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04714   Thermogenesis mpah04720   Long-term potentiation mpah04722   Neurotrophin signaling pathway mpah04725   Cholinergic synapse mpah04726   Serotonergic synapse mpah04730   Long-term depression mpah04810   Regulation of actin cytoskeleton mpah04910   Insulin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04916   Melanogenesis mpah04917   Prolactin signaling pathway mpah04919   Thyroid hormone signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04929   GnRH secretion mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04935   Growth hormone synthesis, secretion and action mpah05010   Alzheimer disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05034   Alcoholism mpah05132   Salmonella infection mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05163   Human cytomegalovirus infection mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05205   Proteoglycans in cancer mpah05206   MicroRNAs in cancer mpah05210   Colorectal cancer mpah05211   Renal cell carcinoma mpah05213   Endometrial cancer mpah05214   Glioma mpah05215   Prostate cancer mpah05216   Thyroid cancer mpah05218   Melanoma mpah05219   Bladder cancer mpah05220   Chronic myeloid leukemia mpah05221   Acute myeloid leukemia mpah05223   Non-small cell lung cancer mpah05224   Breast cancer mpah05225   Hepatocellular carcinoma mpah05226   Gastric cancer mpah05230   Central carbon metabolism in cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110318967    04012 ErbB signaling pathway     110318967    04014 Ras signaling pathway     110318967    04015 Rap1 signaling pathway     110318967    04370 VEGF signaling pathway     110318967    04371 Apelin signaling pathway     110318967    04630 JAK-STAT signaling pathway     110318967    04068 FoxO signaling pathway     110318967    04072 Phospholipase D signaling pathway     110318967    04071 Sphingolipid signaling pathway     110318967    04151 PI3K-Akt signaling pathway     110318967    04150 mTOR signaling pathway     110318967  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110318967    04140 Autophagy - animal     110318967    04137 Mitophagy - animal     110318967   09143 Cell growth and death    04210 Apoptosis     110318967    04218 Cellular senescence     110318967   09144 Cellular community - eukaryotes    04510 Focal adhesion     110318967    04540 Gap junction     110318967    04550 Signaling pathways regulating pluripotency of stem cells     110318967   09142 Cell motility    04810 Regulation of actin cytoskeleton     110318967  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110318967    04650 Natural killer cell mediated cytotoxicity     110318967    04660 T cell receptor signaling pathway     110318967    04662 B cell receptor signaling pathway     110318967    04664 Fc epsilon RI signaling pathway     110318967    04062 Chemokine signaling pathway     110318967   09152 Endocrine system    04910 Insulin signaling pathway     110318967    04929 GnRH secretion     110318967    04912 GnRH signaling pathway     110318967    04915 Estrogen signaling pathway     110318967    04917 Prolactin signaling pathway     110318967    04921 Oxytocin signaling pathway     110318967    04926 Relaxin signaling pathway     110318967    04935 Growth hormone synthesis, secretion and action     110318967    04919 Thyroid hormone signaling pathway     110318967    04916 Melanogenesis     110318967   09156 Nervous system    04725 Cholinergic synapse     110318967    04726 Serotonergic synapse     110318967    04720 Long-term potentiation     110318967    04730 Long-term depression     110318967    04722 Neurotrophin signaling pathway     110318967   09158 Development and regeneration    04360 Axon guidance     110318967   09149 Aging    04211 Longevity regulating pathway     110318967    04213 Longevity regulating pathway - multiple species     110318967   09159 Environmental adaptation    04714 Thermogenesis     110318967  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110318967    05206 MicroRNAs in cancer     110318967    05205 Proteoglycans in cancer     110318967    05203 Viral carcinogenesis     110318967    05230 Central carbon metabolism in cancer     110318967    05231 Choline metabolism in cancer     110318967    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110318967   09162 Cancer: specific types    05210 Colorectal cancer     110318967    05225 Hepatocellular carcinoma     110318967    05226 Gastric cancer     110318967    05214 Glioma     110318967    05216 Thyroid cancer     110318967    05221 Acute myeloid leukemia     110318967    05220 Chronic myeloid leukemia     110318967    05218 Melanoma     110318967    05211 Renal cell carcinoma     110318967    05219 Bladder cancer     110318967    05215 Prostate cancer     110318967    05213 Endometrial cancer     110318967    05224 Breast cancer     110318967    05223 Non-small cell lung cancer     110318967   09164 Neurodegenerative disease    05010 Alzheimer disease     110318967    05022 Pathways of neurodegeneration - multiple diseases     110318967   09165 Substance dependence    05034 Alcoholism     110318967   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110318967   09171 Infectious disease: bacterial    05132 Salmonella infection     110318967   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110318967    05170 Human immunodeficiency virus 1 infection     110318967    05161 Hepatitis B     110318967    05160 Hepatitis C     110318967    05163 Human cytomegalovirus infection     110318967    05167 Kaposi sarcoma-associated herpesvirus infection     110318967    05165 Human papillomavirus infection     110318967   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110318967    01522 Endocrine resistance     110318967  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110318967   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110318967    04031 GTP-binding proteins [BR:mpah04031]     110318967 Membrane trafficking [BR:mpah04131]  Endocytosis   Macropinocytosis    Ras GTPases     110318967 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110318967   Exosomal proteins of colorectal cancer cells    110318967 GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110318967 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase FeoB_N Motif Other DBs NCBI-GeneID:  110318967 NCBI-ProteinID:  XP_021049990 LinkDB All DBs Position 3 AA seq 166 aa AA seqDB search MTEYKLVAVGAGAMGKSALTIQLIRNHFVDEHDPTIEDSYRKQVVIDGETCVLDILDTSG QEEYSAMRDQYMHTGEGFLCVFAINNTKSFEDIHQYREQIKWVRDSDDVPTVLVDNKCDL AAGTVEFRQAQDLAHSYGIPYIETSAKTRQGVEDAFVTLVCEIQRY NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagcttgtggcggtgggcgctggagccatgggcaagagtgccctgacc atccagctgatccggaaccactttgtggatgagcatgatcccaccatagaggactcctac cgaaaacaggtggtcattgatggggagacatgtgtactggacatcttagacacatcaggt caagaagagtatagtgccatgagggaccagtacatgcacacaggggagggcttcctctgt gtatttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc aagtgggtgagagattcagatgatgtgccaacggtgttggtggacaacaagtgtgacctg gccgctggcactgttgagtttcggcaggcccaggaccttgctcacagttatggcatcccc tacattgaaacatcagccaagactcggcaaggtgtggaggatgccttcgttacactagtc tgtgagattcagaggtactga

Mus pahari (shrew mouse): 110319567 Help Entry 110319567         CDS       T05929                                  Gene name Hras Definition (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04012   ErbB signaling pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04062   Chemokine signaling pathway mpah04068   FoxO signaling pathway mpah04071   Sphingolipid signaling pathway mpah04072   Phospholipase D signaling pathway mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah04144   Endocytosis mpah04150   mTOR signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04211   Longevity regulating pathway mpah04213   Longevity regulating pathway - multiple species mpah04218   Cellular senescence mpah04360   Axon guidance mpah04370   VEGF signaling pathway mpah04371   Apelin signaling pathway mpah04510   Focal adhesion mpah04540   Gap junction mpah04550   Signaling pathways regulating pluripotency of stem cells mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04714   Thermogenesis mpah04720   Long-term potentiation mpah04722   Neurotrophin signaling pathway mpah04725   Cholinergic synapse mpah04726   Serotonergic synapse mpah04730   Long-term depression mpah04810   Regulation of actin cytoskeleton mpah04910   Insulin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04916   Melanogenesis mpah04917   Prolactin signaling pathway mpah04919   Thyroid hormone signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04929   GnRH secretion mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04935   Growth hormone synthesis, secretion and action mpah05010   Alzheimer disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05034   Alcoholism mpah05132   Salmonella infection mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05163   Human cytomegalovirus infection mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05205   Proteoglycans in cancer mpah05206   MicroRNAs in cancer mpah05210   Colorectal cancer mpah05211   Renal cell carcinoma mpah05213   Endometrial cancer mpah05214   Glioma mpah05215   Prostate cancer mpah05216   Thyroid cancer mpah05218   Melanoma mpah05219   Bladder cancer mpah05220   Chronic myeloid leukemia mpah05221   Acute myeloid leukemia mpah05223   Non-small cell lung cancer mpah05224   Breast cancer mpah05225   Hepatocellular carcinoma mpah05226   Gastric cancer mpah05230   Central carbon metabolism in cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110319567 (Hras)    04012 ErbB signaling pathway     110319567 (Hras)    04014 Ras signaling pathway     110319567 (Hras)    04015 Rap1 signaling pathway     110319567 (Hras)    04370 VEGF signaling pathway     110319567 (Hras)    04371 Apelin signaling pathway     110319567 (Hras)    04630 JAK-STAT signaling pathway     110319567 (Hras)    04068 FoxO signaling pathway     110319567 (Hras)    04072 Phospholipase D signaling pathway     110319567 (Hras)    04071 Sphingolipid signaling pathway     110319567 (Hras)    04151 PI3K-Akt signaling pathway     110319567 (Hras)    04150 mTOR signaling pathway     110319567 (Hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110319567 (Hras)    04140 Autophagy - animal     110319567 (Hras)    04137 Mitophagy - animal     110319567 (Hras)   09143 Cell growth and death    04210 Apoptosis     110319567 (Hras)    04218 Cellular senescence     110319567 (Hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110319567 (Hras)    04540 Gap junction     110319567 (Hras)    04550 Signaling pathways regulating pluripotency of stem cells     110319567 (Hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     110319567 (Hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110319567 (Hras)    04650 Natural killer cell mediated cytotoxicity     110319567 (Hras)    04660 T cell receptor signaling pathway     110319567 (Hras)    04662 B cell receptor signaling pathway     110319567 (Hras)    04664 Fc epsilon RI signaling pathway     110319567 (Hras)    04062 Chemokine signaling pathway     110319567 (Hras)   09152 Endocrine system    04910 Insulin signaling pathway     110319567 (Hras)    04929 GnRH secretion     110319567 (Hras)    04912 GnRH signaling pathway     110319567 (Hras)    04915 Estrogen signaling pathway     110319567 (Hras)    04917 Prolactin signaling pathway     110319567 (Hras)    04921 Oxytocin signaling pathway     110319567 (Hras)    04926 Relaxin signaling pathway     110319567 (Hras)    04935 Growth hormone synthesis, secretion and action     110319567 (Hras)    04919 Thyroid hormone signaling pathway     110319567 (Hras)    04916 Melanogenesis     110319567 (Hras)   09156 Nervous system    04725 Cholinergic synapse     110319567 (Hras)    04726 Serotonergic synapse     110319567 (Hras)    04720 Long-term potentiation     110319567 (Hras)    04730 Long-term depression     110319567 (Hras)    04722 Neurotrophin signaling pathway     110319567 (Hras)   09158 Development and regeneration    04360 Axon guidance     110319567 (Hras)   09149 Aging    04211 Longevity regulating pathway     110319567 (Hras)    04213 Longevity regulating pathway - multiple species     110319567 (Hras)   09159 Environmental adaptation    04714 Thermogenesis     110319567 (Hras)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110319567 (Hras)    05206 MicroRNAs in cancer     110319567 (Hras)    05205 Proteoglycans in cancer     110319567 (Hras)    05203 Viral carcinogenesis     110319567 (Hras)    05230 Central carbon metabolism in cancer     110319567 (Hras)    05231 Choline metabolism in cancer     110319567 (Hras)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110319567 (Hras)   09162 Cancer: specific types    05210 Colorectal cancer     110319567 (Hras)    05225 Hepatocellular carcinoma     110319567 (Hras)    05226 Gastric cancer     110319567 (Hras)    05214 Glioma     110319567 (Hras)    05216 Thyroid cancer     110319567 (Hras)    05221 Acute myeloid leukemia     110319567 (Hras)    05220 Chronic myeloid leukemia     110319567 (Hras)    05218 Melanoma     110319567 (Hras)    05211 Renal cell carcinoma     110319567 (Hras)    05219 Bladder cancer     110319567 (Hras)    05215 Prostate cancer     110319567 (Hras)    05213 Endometrial cancer     110319567 (Hras)    05224 Breast cancer     110319567 (Hras)    05223 Non-small cell lung cancer     110319567 (Hras)   09164 Neurodegenerative disease    05010 Alzheimer disease     110319567 (Hras)    05022 Pathways of neurodegeneration - multiple diseases     110319567 (Hras)   09165 Substance dependence    05034 Alcoholism     110319567 (Hras)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110319567 (Hras)   09171 Infectious disease: bacterial    05132 Salmonella infection     110319567 (Hras)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110319567 (Hras)    05170 Human immunodeficiency virus 1 infection     110319567 (Hras)    05161 Hepatitis B     110319567 (Hras)    05160 Hepatitis C     110319567 (Hras)    05163 Human cytomegalovirus infection     110319567 (Hras)    05167 Kaposi sarcoma-associated herpesvirus infection     110319567 (Hras)    05165 Human papillomavirus infection     110319567 (Hras)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110319567 (Hras)    01522 Endocrine resistance     110319567 (Hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110319567 (Hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110319567 (Hras)    04031 GTP-binding proteins [BR:mpah04031]     110319567 (Hras) Membrane trafficking [BR:mpah04131]  Endocytosis   Macropinocytosis    Ras GTPases     110319567 (Hras) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110319567 (Hras)   Exosomal proteins of colorectal cancer cells    110319567 (Hras) GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110319567 (Hras) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA G-alpha ATP_bind_1 Septin Ldh_1_N AAA_25 AAA_16 Motif Other DBs NCBI-GeneID:  110319567 NCBI-ProteinID:  XP_021050707 Ensembl:  MGP_PahariEiJ_G0013880 LinkDB All DBs Position 1 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL ATRTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMSCKCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagcttgtggtggtgggcgctggaggcgtgggcaagagtgccctgacc atccagctgatccagaaccactttgtggacgagtatgatcccaccatagaggactcctac cggaaacaggtggtcattgatggggagacatgtctactggacatcttagacacagcaggt caagaagaatatagcgccatgcgggaccagtacatgcgcacaggggagggcttcctctgt gtatttgccatcaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc aagcgggtgaaagattcagatgatgtgccaatggtgctggtgggcaacaagtgtgacctg gccactcgcactgttgagtctcggcaggcccaggaccttgctcgcagctatggcatcccc tacattgaaacatcagccaagacccggcagggtgtggaggatgccttctatacgctagtc cgtgagattcggcagcataaactgcggaaactgaacccgcctgatgagagtggtcctggc tgcatgagctgcaagtgtgtgttgtcctga

Mus pahari (shrew mouse): 110333346 Help Entry 110333346         CDS       T05929                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04012   ErbB signaling pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04062   Chemokine signaling pathway mpah04068   FoxO signaling pathway mpah04071   Sphingolipid signaling pathway mpah04072   Phospholipase D signaling pathway mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah04144   Endocytosis mpah04150   mTOR signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04211   Longevity regulating pathway mpah04213   Longevity regulating pathway - multiple species mpah04218   Cellular senescence mpah04360   Axon guidance mpah04370   VEGF signaling pathway mpah04371   Apelin signaling pathway mpah04510   Focal adhesion mpah04540   Gap junction mpah04550   Signaling pathways regulating pluripotency of stem cells mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04714   Thermogenesis mpah04720   Long-term potentiation mpah04722   Neurotrophin signaling pathway mpah04725   Cholinergic synapse mpah04726   Serotonergic synapse mpah04730   Long-term depression mpah04810   Regulation of actin cytoskeleton mpah04910   Insulin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04916   Melanogenesis mpah04917   Prolactin signaling pathway mpah04919   Thyroid hormone signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04929   GnRH secretion mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04935   Growth hormone synthesis, secretion and action mpah05010   Alzheimer disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05034   Alcoholism mpah05132   Salmonella infection mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05163   Human cytomegalovirus infection mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05205   Proteoglycans in cancer mpah05206   MicroRNAs in cancer mpah05210   Colorectal cancer mpah05211   Renal cell carcinoma mpah05213   Endometrial cancer mpah05214   Glioma mpah05215   Prostate cancer mpah05216   Thyroid cancer mpah05218   Melanoma mpah05219   Bladder cancer mpah05220   Chronic myeloid leukemia mpah05221   Acute myeloid leukemia mpah05223   Non-small cell lung cancer mpah05224   Breast cancer mpah05225   Hepatocellular carcinoma mpah05226   Gastric cancer mpah05230   Central carbon metabolism in cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110333346    04012 ErbB signaling pathway     110333346    04014 Ras signaling pathway     110333346    04015 Rap1 signaling pathway     110333346    04370 VEGF signaling pathway     110333346    04371 Apelin signaling pathway     110333346    04630 JAK-STAT signaling pathway     110333346    04068 FoxO signaling pathway     110333346    04072 Phospholipase D signaling pathway     110333346    04071 Sphingolipid signaling pathway     110333346    04151 PI3K-Akt signaling pathway     110333346    04150 mTOR signaling pathway     110333346  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110333346    04140 Autophagy - animal     110333346    04137 Mitophagy - animal     110333346   09143 Cell growth and death    04210 Apoptosis     110333346    04218 Cellular senescence     110333346   09144 Cellular community - eukaryotes    04510 Focal adhesion     110333346    04540 Gap junction     110333346    04550 Signaling pathways regulating pluripotency of stem cells     110333346   09142 Cell motility    04810 Regulation of actin cytoskeleton     110333346  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110333346    04650 Natural killer cell mediated cytotoxicity     110333346    04660 T cell receptor signaling pathway     110333346    04662 B cell receptor signaling pathway     110333346    04664 Fc epsilon RI signaling pathway     110333346    04062 Chemokine signaling pathway     110333346   09152 Endocrine system    04910 Insulin signaling pathway     110333346    04929 GnRH secretion     110333346    04912 GnRH signaling pathway     110333346    04915 Estrogen signaling pathway     110333346    04917 Prolactin signaling pathway     110333346    04921 Oxytocin signaling pathway     110333346    04926 Relaxin signaling pathway     110333346    04935 Growth hormone synthesis, secretion and action     110333346    04919 Thyroid hormone signaling pathway     110333346    04916 Melanogenesis     110333346   09156 Nervous system    04725 Cholinergic synapse     110333346    04726 Serotonergic synapse     110333346    04720 Long-term potentiation     110333346    04730 Long-term depression     110333346    04722 Neurotrophin signaling pathway     110333346   09158 Development and regeneration    04360 Axon guidance     110333346   09149 Aging    04211 Longevity regulating pathway     110333346    04213 Longevity regulating pathway - multiple species     110333346   09159 Environmental adaptation    04714 Thermogenesis     110333346  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110333346    05206 MicroRNAs in cancer     110333346    05205 Proteoglycans in cancer     110333346    05203 Viral carcinogenesis     110333346    05230 Central carbon metabolism in cancer     110333346    05231 Choline metabolism in cancer     110333346    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110333346   09162 Cancer: specific types    05210 Colorectal cancer     110333346    05225 Hepatocellular carcinoma     110333346    05226 Gastric cancer     110333346    05214 Glioma     110333346    05216 Thyroid cancer     110333346    05221 Acute myeloid leukemia     110333346    05220 Chronic myeloid leukemia     110333346    05218 Melanoma     110333346    05211 Renal cell carcinoma     110333346    05219 Bladder cancer     110333346    05215 Prostate cancer     110333346    05213 Endometrial cancer     110333346    05224 Breast cancer     110333346    05223 Non-small cell lung cancer     110333346   09164 Neurodegenerative disease    05010 Alzheimer disease     110333346    05022 Pathways of neurodegeneration - multiple diseases     110333346   09165 Substance dependence    05034 Alcoholism     110333346   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110333346   09171 Infectious disease: bacterial    05132 Salmonella infection     110333346   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110333346    05170 Human immunodeficiency virus 1 infection     110333346    05161 Hepatitis B     110333346    05160 Hepatitis C     110333346    05163 Human cytomegalovirus infection     110333346    05167 Kaposi sarcoma-associated herpesvirus infection     110333346    05165 Human papillomavirus infection     110333346   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110333346    01522 Endocrine resistance     110333346  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110333346   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110333346    04031 GTP-binding proteins [BR:mpah04031]     110333346 Membrane trafficking [BR:mpah04131]  Endocytosis   Macropinocytosis    Ras GTPases     110333346 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110333346   Exosomal proteins of colorectal cancer cells    110333346 GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110333346 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N PglD_N CbiA ATP_bind_1 AAA_25 TniB NB-ARC CspB_prodomain Ribosomal_L25p Motif Other DBs NCBI-GeneID:  110333346 NCBI-ProteinID:  XP_021070598 LinkDB All DBs Position 15 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSVLTIQLIQNHFVGEYDPTIEDSYGKKVVIDGETCLLDILDTTG QEEYSTMRDQYMCTGEGFLCIFSTNNTKSFEDIHQYREQIKRVKNSNDVPMVLVGNKYDL AACTVESQQAQDLARSYGISYIETSVKTRQGVEDTFYTLVHEIRQQKLWRVNLPDESGPG CMSCNCVLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagcttgtggtggtgggcgctggaggcgtgggcaagagtgtcctgacc atccagctgatccaaaaccactttgtgggcgagtatgatcccactatagaggactcctat ggaaaaaaggtggtcattgatggggagacatgtctactggacatcttagacacaacaggt caagaagagtatagcaccatgcgggaccagtacatgtgcacaggggagggcttcctctgt atattttccaccaacaacaccaagtccttcgaagacatccatcagtacagggagcagatc aagcgggtgaaaaattcaaatgatgtgccaatggtgttggtgggcaacaagtatgacctg gccgcttgcactgttgagtctcagcaggcccaggaccttgctcgtagctatggcatctcc tacattgaaacatcagtcaagactcggcagggtgtggaggataccttctatacactagtc catgagattcggcagcaaaaactttggagagtgaacctgcctgatgagagtggtcctggc tgcatgagctgcaattgtgtgctgtcctga

Mus pahari (shrew mouse): 110338480 Help Entry 110338480         CDS       T05929                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism mpah  Mus pahari (shrew mouse) Pathway mpah01521   EGFR tyrosine kinase inhibitor resistance mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04012   ErbB signaling pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04062   Chemokine signaling pathway mpah04068   FoxO signaling pathway mpah04071   Sphingolipid signaling pathway mpah04072   Phospholipase D signaling pathway mpah04137   Mitophagy - animal mpah04140   Autophagy - animal mpah04144   Endocytosis mpah04150   mTOR signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04211   Longevity regulating pathway mpah04213   Longevity regulating pathway - multiple species mpah04218   Cellular senescence mpah04360   Axon guidance mpah04370   VEGF signaling pathway mpah04371   Apelin signaling pathway mpah04510   Focal adhesion mpah04540   Gap junction mpah04550   Signaling pathways regulating pluripotency of stem cells mpah04625   C-type lectin receptor signaling pathway mpah04630   JAK-STAT signaling pathway mpah04650   Natural killer cell mediated cytotoxicity mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04714   Thermogenesis mpah04720   Long-term potentiation mpah04722   Neurotrophin signaling pathway mpah04725   Cholinergic synapse mpah04726   Serotonergic synapse mpah04730   Long-term depression mpah04810   Regulation of actin cytoskeleton mpah04910   Insulin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04916   Melanogenesis mpah04917   Prolactin signaling pathway mpah04919   Thyroid hormone signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04929   GnRH secretion mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04935   Growth hormone synthesis, secretion and action mpah05010   Alzheimer disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05034   Alcoholism mpah05132   Salmonella infection mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05163   Human cytomegalovirus infection mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05205   Proteoglycans in cancer mpah05206   MicroRNAs in cancer mpah05210   Colorectal cancer mpah05211   Renal cell carcinoma mpah05213   Endometrial cancer mpah05214   Glioma mpah05215   Prostate cancer mpah05216   Thyroid cancer mpah05218   Melanoma mpah05219   Bladder cancer mpah05220   Chronic myeloid leukemia mpah05221   Acute myeloid leukemia mpah05223   Non-small cell lung cancer mpah05224   Breast cancer mpah05225   Hepatocellular carcinoma mpah05226   Gastric cancer mpah05230   Central carbon metabolism in cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110338480    04012 ErbB signaling pathway     110338480    04014 Ras signaling pathway     110338480    04015 Rap1 signaling pathway     110338480    04370 VEGF signaling pathway     110338480    04371 Apelin signaling pathway     110338480    04630 JAK-STAT signaling pathway     110338480    04068 FoxO signaling pathway     110338480    04072 Phospholipase D signaling pathway     110338480    04071 Sphingolipid signaling pathway     110338480    04151 PI3K-Akt signaling pathway     110338480    04150 mTOR signaling pathway     110338480  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110338480    04140 Autophagy - animal     110338480    04137 Mitophagy - animal     110338480   09143 Cell growth and death    04210 Apoptosis     110338480    04218 Cellular senescence     110338480   09144 Cellular community - eukaryotes    04510 Focal adhesion     110338480    04540 Gap junction     110338480    04550 Signaling pathways regulating pluripotency of stem cells     110338480   09142 Cell motility    04810 Regulation of actin cytoskeleton     110338480  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     110338480    04650 Natural killer cell mediated cytotoxicity     110338480    04660 T cell receptor signaling pathway     110338480    04662 B cell receptor signaling pathway     110338480    04664 Fc epsilon RI signaling pathway     110338480    04062 Chemokine signaling pathway     110338480   09152 Endocrine system    04910 Insulin signaling pathway     110338480    04929 GnRH secretion     110338480    04912 GnRH signaling pathway     110338480    04915 Estrogen signaling pathway     110338480    04917 Prolactin signaling pathway     110338480    04921 Oxytocin signaling pathway     110338480    04926 Relaxin signaling pathway     110338480    04935 Growth hormone synthesis, secretion and action     110338480    04919 Thyroid hormone signaling pathway     110338480    04916 Melanogenesis     110338480   09156 Nervous system    04725 Cholinergic synapse     110338480    04726 Serotonergic synapse     110338480    04720 Long-term potentiation     110338480    04730 Long-term depression     110338480    04722 Neurotrophin signaling pathway     110338480   09158 Development and regeneration    04360 Axon guidance     110338480   09149 Aging    04211 Longevity regulating pathway     110338480    04213 Longevity regulating pathway - multiple species     110338480   09159 Environmental adaptation    04714 Thermogenesis     110338480  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110338480    05206 MicroRNAs in cancer     110338480    05205 Proteoglycans in cancer     110338480    05203 Viral carcinogenesis     110338480    05230 Central carbon metabolism in cancer     110338480    05231 Choline metabolism in cancer     110338480    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110338480   09162 Cancer: specific types    05210 Colorectal cancer     110338480    05225 Hepatocellular carcinoma     110338480    05226 Gastric cancer     110338480    05214 Glioma     110338480    05216 Thyroid cancer     110338480    05221 Acute myeloid leukemia     110338480    05220 Chronic myeloid leukemia     110338480    05218 Melanoma     110338480    05211 Renal cell carcinoma     110338480    05219 Bladder cancer     110338480    05215 Prostate cancer     110338480    05213 Endometrial cancer     110338480    05224 Breast cancer     110338480    05223 Non-small cell lung cancer     110338480   09164 Neurodegenerative disease    05010 Alzheimer disease     110338480    05022 Pathways of neurodegeneration - multiple diseases     110338480   09165 Substance dependence    05034 Alcoholism     110338480   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110338480   09171 Infectious disease: bacterial    05132 Salmonella infection     110338480   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110338480    05170 Human immunodeficiency virus 1 infection     110338480    05161 Hepatitis B     110338480    05160 Hepatitis C     110338480    05163 Human cytomegalovirus infection     110338480    05167 Kaposi sarcoma-associated herpesvirus infection     110338480    05165 Human papillomavirus infection     110338480   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     110338480    01522 Endocrine resistance     110338480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110338480   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110338480    04031 GTP-binding proteins [BR:mpah04031]     110338480 Membrane trafficking [BR:mpah04131]  Endocytosis   Macropinocytosis    Ras GTPases     110338480 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    110338480   Exosomal proteins of colorectal cancer cells    110338480 GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     110338480 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase ATP_bind_1 FeoB_N MMR_HSR1 Septin Motif Other DBs NCBI-GeneID:  110338480 NCBI-ProteinID:  XP_021077476 LinkDB All DBs Position 21 AA seq 189 aa AA seqDB search MTEYQLVVVGAGGLGKSALTIQLIQNYFVDEYDPTIADSYRKQVVIDGETCLLDILDTTG QEEYSAMWDQYMQTGEGFLCIFAINNTKSFEDIHQYREQIKQVKNSDDLPMVLVGNKCDL AARTVEPRQTQDLSHSYGIPYIETTAKTRQGVEDAFYMLVREILQQKLQRLNLPHDSGPD CMSCKCVLF NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaataccagcttgtggttgtgggtgctggaggcctgggcaagagtgccctgacc atccagctgatccaaaactactttgtggatgaatatgatcccactatagcggactcctac cgaaaacaggtggtcattgatggggagacatgtctactggacatcttagacacaacaggt caagaagagtatagtgccatgtgggaccagtacatgcaaacaggggagggcttcctctgt atatttgccatcaacaacaccaagtcctttgaagacatccatcagtacagggagcagatc aagcaggtaaaaaattcagatgatttgccaatggtgctggtgggcaacaagtgtgacctg gccgctcgcactgttgagcctcggcagacccaggacctttctcacagctatggcatcccc tacattgaaacaacagccaagactcggcaaggtgtggaggatgccttctatatgctagtc cgtgagattctgcagcaaaaactacagagactgaacctgcctcatgacagtggtcctgac tgcatgagctgcaagtgtgtgctgttctga

DBGET integrated database retrieval system