KEGG   Mus pahari (shrew mouse): 110318968
Entry
110318968         CDS       T05929                                 

Gene name
Id1
Definition
(RefSeq) DNA-binding protein inhibitor ID-1
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110318968 (Id1)
   04350 TGF-beta signaling pathway
    110318968 (Id1)
   04390 Hippo signaling pathway
    110318968 (Id1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110318968 (Id1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110318968 (Id1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    110318968 (Id1)
SSDB
Motif
Pfam: HLH Dsl1_N
Other DBs
NCBI-GeneID: 110318968
NCBI-ProteinID: XP_021049992
Ensembl: MGP_PahariEiJ_G0025914
LinkDB
Position
3
AA seq 148 aa
MKVAGGSAAAAAGPSCSLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLY
DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTAGGRGLPVRA
PLSTLNGEISALAAEAACVPADDRILCR
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaggtcgccggtggcagtgccgcagccgctgcaggccccagttgttctctgaaggcg
ggcaggacagcgggcgaggtggtacttggtctgtcggagcaaagcgtggccatctcgcgc
tgcgccgggacacgcctgcccgccttgctggacgagcagcaggtgaacgtcctgctctac
gacatgaacggctgctactcacgcctcaaggagctggtgcccaccctgcctcagaaccgc
aaagtgagcaaggtggagatcctgcagcatgtaattgactacatcagggacctgcagctg
gagctgaactcggagtctgaagtcgggaccgccggaggccgggggttgccagtccgtgcc
ccgctcagcaccctgaatggcgagatcagtgccttggcggccgaggcggcatgtgttcca
gccgacgatcgcatcttgtgtcgctga

DBGET integrated database retrieval system