KEGG   Mus pahari (shrew mouse): 110319597
Entry
110319597         CDS       T05929                                 

Gene name
Ddb2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah03420  Nucleotide excision repair
mpah04115  p53 signaling pathway
mpah04120  Ubiquitin mediated proteolysis
mpah05161  Hepatitis B
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110319597 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    110319597 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110319597 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319597 (Ddb2)
   05202 Transcriptional misregulation in cancer
    110319597 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110319597 (Ddb2)
   05212 Pancreatic cancer
    110319597 (Ddb2)
   05225 Hepatocellular carcinoma
    110319597 (Ddb2)
   05226 Gastric cancer
    110319597 (Ddb2)
   05214 Glioma
    110319597 (Ddb2)
   05216 Thyroid cancer
    110319597 (Ddb2)
   05220 Chronic myeloid leukemia
    110319597 (Ddb2)
   05217 Basal cell carcinoma
    110319597 (Ddb2)
   05218 Melanoma
    110319597 (Ddb2)
   05213 Endometrial cancer
    110319597 (Ddb2)
   05224 Breast cancer
    110319597 (Ddb2)
   05222 Small cell lung cancer
    110319597 (Ddb2)
   05223 Non-small cell lung cancer
    110319597 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110319597 (Ddb2)
   05169 Epstein-Barr virus infection
    110319597 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110319597 (Ddb2)
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110319597 (Ddb2)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     110319597 (Ddb2)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      110319597 (Ddb2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 110319597
NCBI-ProteinID: XP_021050751
Ensembl: MGP_PahariEiJ_G0025394
LinkDB
Position
3
AA seq 432 aa
MAPKKCPETQKSPDVALLLRSKSRRGPQELEPEAKKLRVQGPVSSRTCESCCLLAELSSW
QIPPRSSSIVRDLYQRKLGKTTWSSLQQGLQKSFLHSLASYQVFRKAAPFDRRTTSLAWH
PTHPSTLAVGSKGGDIMIWNFGIKDKPIFLKGIGAGGSITGLKFNHLNTNQFFASSMEGT
TRLQDFKGNILRVYTSSNSCKVWFCSLDVSAKSRVVVTGDNMGHVILMSTDGKELWNLRM
HKKKVAHVALNPCCDWLLATASIDQTVKIWDLRQIKGKDSFLYSLPHRHPVNAACFSPDG
ARLLTTDQNNEIRVYSASQWDSPLNLISHPHRHFQHLTPIKATWHSRHNLIVVGRYPDPN
LKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASTMGYHILIWSQ
EKDGSQKAHEKL
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctcccaagaaatgcccagaaacccagaagtcccccgacgttgcgctgctcctcagg
agcaaaagtcgcagaggtcctcaggagctggagcccgaagccaagaagctgcgtgtgcag
ggtcccgtttctagcaggacatgtgagtcgtgctgccttctggcagagttgtccagctgg
cagatccctccacggagtagcagcattgtcagggatctttaccagcgtaagttgggcaaa
accacctggtcatcactacagcagggtctgcagaagtcctttttgcactctctagcttct
taccaggtattccgaaaagctgccccctttgacaggaggactacgtccttggcatggcac
ccgactcatcccagtaccctggctgtgggctccaaagggggagatattatgatctggaac
tttggcataaaggacaaacctatcttccttaaagggattggagctggaggaagcatcact
gggctgaagtttaaccatctcaataccaaccagttttttgcctcctcaatggagggaaca
accaggctgcaggattttaaaggcaacattctcagagtttataccagctcaaactcttgc
aaggtctggttttgcagccttgacgtttctgccaagagcagagtggtggttacaggagac
aatatgggacacgtgatcctgatgagcacagatggcaaggagctttggaacctcagaatg
cacaaaaagaaagtagcccacgtggccctgaatccctgctgtgattggcttctggccaca
gcctcaatagatcaaacagtgaagatttgggacctgcgccaaattaaagggaaagacagc
ttcctgtactcactgcctcacaggcatcctgtcaatgcagcttgttttagcccagatgga
gctcggctcctgactactgaccagaacaatgagattcgggtttactctgcctcccagtgg
gatagccccctgaatctgatctcccaccctcaccgccattttcagcacctcacacccatc
aaggcgacctggcattcacggcacaacctcatcgttgtgggccgatacccagaccctaat
cttaaaagttgtgttccctatgaactaaggacaatagatgtgtttgatggaagctcgggg
aagatgatgtgtcagctctatgatccaggatattccggtattacttcgctcaatgagttt
aatcctatgggagacacactggcctctactatgggttatcatattctcatttggagccaa
gagaaagatgggtcacagaaagctcatgaaaaactatga

DBGET integrated database retrieval system