KEGG   Mus pahari (shrew mouse): 110319737
Entry
110319737         CDS       T05929                                 

Gene name
Bmpr1b
Definition
(RefSeq) bone morphogenetic protein receptor type-1B isoform X1
  KO
K13578  bone morphogenetic protein receptor type-1B [EC:2.7.11.30]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110319737 (Bmpr1b)
   04390 Hippo signaling pathway
    110319737 (Bmpr1b)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110319737 (Bmpr1b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110319737 (Bmpr1b)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110319737 (Bmpr1b)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110319737 (Bmpr1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110319737 (Bmpr1b)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110319737 (Bmpr1b)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110319737 (Bmpr1b)
Protein kinases [BR:mpah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110319737 (Bmpr1b)
CD molecules [BR:mpah04090]
 Proteins
  110319737 (Bmpr1b)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp FTA2 Haspin_kinase
Other DBs
NCBI-GeneID: 110319737
NCBI-ProteinID: XP_021050914
Ensembl: MGP_PahariEiJ_G0027139
LinkDB
Position
4
AA seq 502 aa
MLLRSSGKLNVGTKKEDGESTAPTPRPKILRCKCHHHCPEDSVNNICSTDGYCFTMIEED
DSGTPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKDRDFVD
GPIHHKALLISVTVCSLLLVFIILFCYFRYKRQEARPRYSIGLEQDETYIPPGESLRDLI
EQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEAS
WFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS
MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFISD
TNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWEIARRCVSGGIV
EEYQLPYHDLVPSDPSYEDMREIVCMKKLRPSFPNRWSSDECLRQMGKLMTECWAQNPAS
RLTALRVKKTLAKMSESQDIKL
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgctcttacgaagctctggaaaattaaatgtgggcaccaagaaggaggatggagagagt
acagcccccacccctcggcccaagatcctgcgttgtaaatgccaccaccactgtccggaa
gattcagtcaacaatatctgcagcacagatgggtactgcttcacgatgatagaagaagat
gactctggaacgcctgttgtcacctctggatgtctaggactggaagggtcagattttcaa
tgccgtgacactcccattcctcatcaaagaagatcaattgaatgctgcacagaaaggaac
gagtgtaataaagacctccaccccactctgcctcccctcaaggacagagattttgttgat
ggacccatacaccacaaggccttgcttatatctgtgactgtctgcagtttactcttggtc
ttcattattttattctgttacttcaggtataaaagacaagaagcccgacctcggtacagc
attgggctggagcaagatgagacatacattcctcctggagagtccctgagagacttgata
gagcaatctcagagctcgggaagtggatcaggcctccctctgctggtccaaaggacaata
gctaagcaaattcagatggtgaagcagattggaaaaggccgctatggcgaagtgtggatg
ggaaagtggcgtggagaaaaggtagctgtgaaagtgttcttcaccacggaggaagccagc
tggttccgagagactgagatatatcagacggtcctgatgaggcatgagaatatcctgggg
ttcattgctgcagatatcaaaggaactgggtcctggactcagttgtacctcatcacagac
tatcatgaaaacggttctctctatgactatctgaaatccaccaccttagatgcaaagtca
atgctgaagctggcctactcctctgtcagcggcctatgccatttacacacggagatcttt
agcactcaaggcaagccagcaatcgcccatcgagacttgaaaagtaaaaacatcctggtg
aagaaaaatggaacttgctgcatagcagacctgggtttggctgtcaagttcattagtgac
acaaatgaggttgacatcccacccaacacccgggttggcaccaagcgctatatgcctcca
gaagtgctggatgagagcttgaatagaaaccatttccagtcctacattatggctgacatg
tatagctttggactcatcctctgggagattgcaaggagatgtgtttctggaggtatagtg
gaagaataccagcttccctatcacgacctggtgcccagtgacccttcttatgaggacatg
agagaaattgtgtgcatgaagaagttacggccttcattccccaatcgatggagcagtgat
gagtgtctcaggcagatggggaagcttatgacagagtgctgggcgcagaatcctgcctcc
aggctgacggccctgagagttaagaaaacacttgccaaaatgtcagagtcccaggacatt
aaactctga

KEGG   Mus pahari (shrew mouse): 110321925
Entry
110321925         CDS       T05929                                 

Gene name
Bmpr2
Definition
(RefSeq) bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah05206  MicroRNAs in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110321925 (Bmpr2)
   04390 Hippo signaling pathway
    110321925 (Bmpr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110321925 (Bmpr2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110321925 (Bmpr2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    110321925 (Bmpr2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110321925 (Bmpr2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110321925 (Bmpr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110321925 (Bmpr2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110321925 (Bmpr2)
Protein kinases [BR:mpah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110321925 (Bmpr2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp TCAD9 APH ABC1
Other DBs
NCBI-GeneID: 110321925
NCBI-ProteinID: XP_021054185
Ensembl: MGP_PahariEiJ_G0027420
LinkDB
Position
5
AA seq 1035 aa
MTSSLHRPFRVPWLLWAILLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTEYFA
LLNWKVSQVGALSVTPDTDASCFLLIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINE
KNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCR
LAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRL
VRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRCTDL
FPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDC
WDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKIGPY
PDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPSPET
SVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQLTEEDL
ETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQQDF
TQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSNLKQ
VETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNPHAATTQYANGTVPSGQAANIVAHRS
QEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRTNSN
NNNSNPCSEQDVLTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQIGESTQDG
KSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLAEGG
TATTTVSKDIGMNCL
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgacttcctcgctgcatcggccctttcgggtgccctggctgctatgggccatcctgctg
gtcagcactacggctgcttcccagaatcaagaacggctgtgtgcatttaaagatccatat
caacaagaccttgggataggtgagagtcgaatctctcatgaaaatgggacaatattatgt
tccaaagggagcacgtgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaaggatgttggtctcacattggtgatccccaagagtgccactatgaagagtgtgta
gtaactaccaccccaccctcaattcagaatggaacataccgtttttgctgctgtagtaca
gatttatgtaatgtcaactttactgagaactttccacctcctgatacaacaccactcagt
ccacctcattcatttaatcgagatgaaacaataatcattgctttggcatcagtttctgta
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacagagtattttgct
ctcctcaattggaaggttagtcaggtaggagctttgtcagttacaccagacacagacgct
agctgctttttgctgattggacggggtcgatacggagcagtatataaaggttccttggat
gagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaattttataaatgaa
aaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttcatagttgga
gacgagaggctcactgcagacggacgcatggagtatttgcttgtgatggagtattatccc
aatggatctctgtgcaaatatctgagtctccacacaagtgattgggtaagctcttgccgt
ctggctcattctgtgactagaggactggcttatcttcacacagaattaccacgaggagat
cattataaacctgcaatctcccatcgagatttaaacagcaggaacgtcctggtaaagaat
gacggcacgtgtgttatcagtgactttggtttatccatgaggctgactggaaaccggctg
gtgcgccctggggaagaagataatgccgctataagtgaggttggcacaattcgctatatg
gcaccagaagtgctagaaggagctgtgaacctgagagactgtgagtcagctctgaagcaa
gtggacatgtatgcgctcggactcatctactgggaggtgttcatgaggtgtacagacctc
ttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagttggaaaccat
cccacatttgaggatatgcaggttcttgtgtccagagagaagcagagacccaagttccca
gaagcctggaaagaaaatagcctggcagtgaggtcactcaaggaaacaattgaagactgc
tgggaccaggatgcagaggctcggctcactgcacagtgtgccgaggagagaatggctgaa
ctcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaacccaatgtcaact
gctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatcgggccttac
ccagattattcctcttcctcatatattgaagactctatccatcatactgacagcatcgtg
aagaatatttcctctgagcattcgatgtccagcacaccattgacaataggagaaaagaac
cgaaactcaattaattatgaacgacagcaagcacaagctcgaatccctagcccagagaca
agcgtcacaagcctgtccacaaacaccaccaccacaaacaccaccggcctcactccaagc
acgggcatgaccactatatctgagatgccatacccggatgagacacacttgcatgccaca
aatgttgcacagtcaatcgggccaacccctgtctgcttacagctgacagaagaagacttg
gagactaataagctagatccaaaagaagttgataagaacctcaaggaaagctctgatgag
aatctcatggagcattctctgaagcagttcagtgggccagacccattgagcagtaccagt
tctagcttgctttatccactcataaagcttgcagtggaagtgactggacaacaggacttc
acacaggctgcaaatggtcaagcatgtttaattcctgatgttccacctgctcagatctat
cctctccctaagcaacagaaccttcctaagagacctactagtttgcctttgaacaccaaa
aattcaacaaaagaaccccggctaaaatttggcaacaagcacaaatcaaacttgaaacaa
gtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcatgtggtgaca
gtaactatgaatggtgtggcaggtagaagccacaatgttaatccccatgctgccacaacc
cagtatgccaatgggacagtgccatctggccaggcagccaacatagtggcacataggtcc
caagaaatgctgcagaatcaatttattggtgaggataccaggctgaatatcaattccagt
cccgatgagcatgaacctttactgagacgagagcaacaggctggccatgatgaaggggtt
ctggatcgtttggtagataggagggaacggccattagaaggtggccgaacaaattccaat
aacaacaacagcaatccatgttcagaacaagatgtccttacacaaggtgttacaagcaca
gctgcagatcctgggccatcaaagcccagaagagcacagaggcccaattctctggatctt
tcagccacaaatatcctggatggcagcagtatacagataggtgagtcaacacaagatggc
aaatcaggatcaggtgaaaagatcaagagacgtgtgaaaactccatactctcttaagcgg
tggcgcccgtccacctgggtcatctccactgagccgctggactgtgaggtcaacaacaat
ggcagtgacagggcagtccattctaaatctagcactgctgtgtacctcgcagagggaggc
actgccacgaccacagtgtctaaagatataggaatgaattgtctgtga

KEGG   Mus pahari (shrew mouse): 110325344
Entry
110325344         CDS       T05929                                 

Gene name
Bmpr1a
Definition
(RefSeq) bone morphogenetic protein receptor type-1A
  KO
K04673  bone morphogenetic protein receptor type-1A [EC:2.7.11.30]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110325344 (Bmpr1a)
   04390 Hippo signaling pathway
    110325344 (Bmpr1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110325344 (Bmpr1a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110325344 (Bmpr1a)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110325344 (Bmpr1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110325344 (Bmpr1a)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110325344 (Bmpr1a)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110325344 (Bmpr1a)
Protein kinases [BR:mpah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110325344 (Bmpr1a)
CD molecules [BR:mpah04090]
 Proteins
  110325344 (Bmpr1a)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal FTA2 Haspin_kinase APH
Other DBs
NCBI-GeneID: 110325344
NCBI-ProteinID: XP_021058950
Ensembl: MGP_PahariEiJ_G0030138
LinkDB
Position
8
AA seq 532 aa
MTELYTYIRLLGACLFIISHVQGQNLDSMLHGTGVKSDLDQKKPENGVTLAPEDTLPFLK
CYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRR
TIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRWLVVFIAMAVCIVAMIISSSCFCYKHYC
KSISSRGRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQV
GKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTG
SWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAH
RDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDIPLNTRVGTKRYMAPEVLDESLNKN
HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLR
PIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgactgagctatacacttacatcagattattgggagcctgtctgttcatcatttctcat
gttcaagggcagaatctagatagtatgctccatggcactggtgtgaaatcagacttggac
cagaagaagccagaaaatggagtgactttagcaccagaggataccttgcctttcttaaag
tgctattgctcgggacactgcccagatgatgctattaataacacatgcataactaatggc
cattgctttgccattatagaagaagatgatcagggagaaaccacattaacttctgggtgt
atgaagtatgaaggctctgattttcaatgcaaggattcaccaaaagcccagctacgcagg
acaatagaatgttgtcggaccaatctgtgcaaccagtatttgcagcctacactgccccct
gttgttataggtccattctttgatggcagcatccgatggctggttgtgttcatcgccatg
gctgtctgcatagtcgctatgatcatctcctccagctgcttttgttataagcattattgt
aagagtatctcaagcaggggtcgttacaaccgtgatttggaacaggatgaagcatttatt
ccagtaggagaatcattgaaagacctgattgatcagtcccaaagctctgggagtggatct
ggattgcctttattggttcagcgaactattgccaaacagattcagatggttcggcaggtt
ggtaaaggccgttatggagaagtatggatgggtaaatggcgtggtgaaaaagtggctgtc
aaagtgttttttaccactgaagaagctagctggtttagagaaacagaaatctaccagacg
gtgttaatgcgtcatgaaaatatacttggttttatagctgcagacattaaaggcactggt
tcctggactcagctgtatttgattactgattaccatgaaaatggatctctctatgacttc
ctgaaatgtgccacactagacaccagagccctactcaagttagcttattctgctgcctgt
ggtctatgccacctccacacagaaatctatggtacccaaggaaagcctgcaattgctcat
cgagacctgaagagcaaaaacatccttattaagaaaaatggaagttgctgtattgctgac
ctgggcctagctgttaaattcaacagtgatacaaatgaagttgacatacccttgaatact
agggtgggcaccaagcggtacatggctccagaagtgctggatgaaagcctgaataaaaac
catttccagccctacatcatggctgacatctatagctttggtttgatcatctgggaaatg
gctcgtcgctgtattacaggaggaattgtggaggaatatcaattaccatattacaacatg
gtgcccagtgacccatcctatgaggacatgcgtgaggtggtgtgtgtgaaacgcttgcgg
ccaatcgtgtctaaccgctggaacagcgatgaatgtcttcgagcagttttgaagctaatg
tcagaatgctgggctcataatccagcctccagactcacagctttgagaatcaagaagacg
cttgcaaaaatggttgaatcccaggatgtaaagatttga

DBGET integrated database retrieval system