KEGG   Mus pahari (shrew mouse): 110319750
Entry
110319750         CDS       T05929                                 

Gene name
Pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110319750 (Pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110319750 (Pik3ca)
   04014 Ras signaling pathway
    110319750 (Pik3ca)
   04015 Rap1 signaling pathway
    110319750 (Pik3ca)
   04370 VEGF signaling pathway
    110319750 (Pik3ca)
   04630 JAK-STAT signaling pathway
    110319750 (Pik3ca)
   04668 TNF signaling pathway
    110319750 (Pik3ca)
   04066 HIF-1 signaling pathway
    110319750 (Pik3ca)
   04068 FoxO signaling pathway
    110319750 (Pik3ca)
   04070 Phosphatidylinositol signaling system
    110319750 (Pik3ca)
   04072 Phospholipase D signaling pathway
    110319750 (Pik3ca)
   04071 Sphingolipid signaling pathway
    110319750 (Pik3ca)
   04024 cAMP signaling pathway
    110319750 (Pik3ca)
   04151 PI3K-Akt signaling pathway
    110319750 (Pik3ca)
   04152 AMPK signaling pathway
    110319750 (Pik3ca)
   04150 mTOR signaling pathway
    110319750 (Pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110319750 (Pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    110319750 (Pik3ca)
   04218 Cellular senescence
    110319750 (Pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110319750 (Pik3ca)
   04550 Signaling pathways regulating pluripotency of stem cells
    110319750 (Pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110319750 (Pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110319750 (Pik3ca)
   04613 Neutrophil extracellular trap formation
    110319750 (Pik3ca)
   04620 Toll-like receptor signaling pathway
    110319750 (Pik3ca)
   04625 C-type lectin receptor signaling pathway
    110319750 (Pik3ca)
   04650 Natural killer cell mediated cytotoxicity
    110319750 (Pik3ca)
   04660 T cell receptor signaling pathway
    110319750 (Pik3ca)
   04662 B cell receptor signaling pathway
    110319750 (Pik3ca)
   04664 Fc epsilon RI signaling pathway
    110319750 (Pik3ca)
   04666 Fc gamma R-mediated phagocytosis
    110319750 (Pik3ca)
   04670 Leukocyte transendothelial migration
    110319750 (Pik3ca)
   04062 Chemokine signaling pathway
    110319750 (Pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110319750 (Pik3ca)
   04923 Regulation of lipolysis in adipocytes
    110319750 (Pik3ca)
   04929 GnRH secretion
    110319750 (Pik3ca)
   04915 Estrogen signaling pathway
    110319750 (Pik3ca)
   04914 Progesterone-mediated oocyte maturation
    110319750 (Pik3ca)
   04917 Prolactin signaling pathway
    110319750 (Pik3ca)
   04926 Relaxin signaling pathway
    110319750 (Pik3ca)
   04935 Growth hormone synthesis, secretion and action
    110319750 (Pik3ca)
   04919 Thyroid hormone signaling pathway
    110319750 (Pik3ca)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110319750 (Pik3ca)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110319750 (Pik3ca)
  09156 Nervous system
   04725 Cholinergic synapse
    110319750 (Pik3ca)
   04722 Neurotrophin signaling pathway
    110319750 (Pik3ca)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110319750 (Pik3ca)
  09158 Development and regeneration
   04360 Axon guidance
    110319750 (Pik3ca)
   04380 Osteoclast differentiation
    110319750 (Pik3ca)
  09149 Aging
   04211 Longevity regulating pathway
    110319750 (Pik3ca)
   04213 Longevity regulating pathway - multiple species
    110319750 (Pik3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110319750 (Pik3ca)
   05206 MicroRNAs in cancer
    110319750 (Pik3ca)
   05205 Proteoglycans in cancer
    110319750 (Pik3ca)
   05203 Viral carcinogenesis
    110319750 (Pik3ca)
   05230 Central carbon metabolism in cancer
    110319750 (Pik3ca)
   05231 Choline metabolism in cancer
    110319750 (Pik3ca)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110319750 (Pik3ca)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110319750 (Pik3ca)
   05212 Pancreatic cancer
    110319750 (Pik3ca)
   05225 Hepatocellular carcinoma
    110319750 (Pik3ca)
   05226 Gastric cancer
    110319750 (Pik3ca)
   05214 Glioma
    110319750 (Pik3ca)
   05221 Acute myeloid leukemia
    110319750 (Pik3ca)
   05220 Chronic myeloid leukemia
    110319750 (Pik3ca)
   05218 Melanoma
    110319750 (Pik3ca)
   05211 Renal cell carcinoma
    110319750 (Pik3ca)
   05215 Prostate cancer
    110319750 (Pik3ca)
   05213 Endometrial cancer
    110319750 (Pik3ca)
   05224 Breast cancer
    110319750 (Pik3ca)
   05222 Small cell lung cancer
    110319750 (Pik3ca)
   05223 Non-small cell lung cancer
    110319750 (Pik3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110319750 (Pik3ca)
   05017 Spinocerebellar ataxia
    110319750 (Pik3ca)
   05020 Prion disease
    110319750 (Pik3ca)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110319750 (Pik3ca)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110319750 (Pik3ca)
   04932 Non-alcoholic fatty liver disease
    110319750 (Pik3ca)
   04931 Insulin resistance
    110319750 (Pik3ca)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110319750 (Pik3ca)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110319750 (Pik3ca)
   05135 Yersinia infection
    110319750 (Pik3ca)
   05100 Bacterial invasion of epithelial cells
    110319750 (Pik3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110319750 (Pik3ca)
   05170 Human immunodeficiency virus 1 infection
    110319750 (Pik3ca)
   05161 Hepatitis B
    110319750 (Pik3ca)
   05160 Hepatitis C
    110319750 (Pik3ca)
   05171 Coronavirus disease - COVID-19
    110319750 (Pik3ca)
   05164 Influenza A
    110319750 (Pik3ca)
   05162 Measles
    110319750 (Pik3ca)
   05168 Herpes simplex virus 1 infection
    110319750 (Pik3ca)
   05163 Human cytomegalovirus infection
    110319750 (Pik3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110319750 (Pik3ca)
   05169 Epstein-Barr virus infection
    110319750 (Pik3ca)
   05165 Human papillomavirus infection
    110319750 (Pik3ca)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110319750 (Pik3ca)
   05142 Chagas disease
    110319750 (Pik3ca)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110319750 (Pik3ca)
   01524 Platinum drug resistance
    110319750 (Pik3ca)
   01522 Endocrine resistance
    110319750 (Pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110319750 (Pik3ca)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110319750 (Pik3ca)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110319750 (Pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321
Other DBs
NCBI-GeneID: 110319750
NCBI-ProteinID: XP_021050942
Ensembl: MGP_PahariEiJ_G0026360
LinkDB
Position
4
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLVTIKHELFKEARKYPLHQ
LLQDETSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFV
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPID
SFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHTGLSNRLARDNELRENDKEQLRALCTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRSFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRQPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQEYTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFTKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccacgaccatcttcgggtgaactgtggggcatccacttgatgcccccacgaatc
ctagtggaatgtttactccccaatggaatgatagtgactttagaatgcctccgtgaggcc
acactagtcaccatcaaacatgaactgttcaaagaggccaggaaataccctctccatcag
cttctgcaagatgaaacttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacggctttgtgaccttcggctttttcaaccctttttaaaa
gttattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggtttcgtt
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtccaagactttcga
aggaacattctgaatgtttgcaaagaagctgtggacctgcgggatctcaactcgcctcat
agcagagcgatgtatgtctaccctccaaatgtcgagtcttccccagaactgccaaagcac
atctacaacaagttagataaaggacaaatcatagtggtgatttgggtaatagtctctcca
aacaacgacaagcagaagtacactctgaagatcaaccatgactgtgtgccagagcaagtc
attgctgaagccatcaggaaaaagactcgcagcatgctgttgtcctctgagcagctgaaa
ctctgtgtcttagagtatcagggcaagtatattctgaaagtgtgtggctgtgacgaatac
ttcctagaaaagtacccgctgagtcagtacaagtacataagaagctgtataatgctgggg
aggatgcccaacttgatgctgatggccaaggaaagcctatactctcagctgccgattgat
agcttcacaatgccatcatactccaggcgcatctccacagccacaccctacatgaatgga
gagacatcgacaaaatccctctgggtcataaatagtgcgctcagaataaaaattctttgt
gcaacctatgtaaatgtaaatattcgagacattgataagatctatgttcgaacaggtatc
taccatggaggagaacccttatgtgacaatgtgaacactcaaagagtaccttgttccaat
cctaggtggaatgaatggctgaattatgatatatacattcctgatcttcctcgtgctgcg
cgcctttgcctttcaatctgctctgttaaaggccgaaagggtgctaaggaggagcactgt
ccgttggcctggggaaacataaacttgtttgattatacagacaccctggtgtccgggaaa
atggctttgaatctctggcctgtaccacatgggttagaagacctgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccgtgcttagagttggaatttgattggttc
agcagtgtggtgaagtttccagacatgtctgtgattgaagaacatgccaattggtctgtg
tcccgagaagctggattcagttactctcatacaggactgagtaacagactagccagagac
aatgagttaagagaaaatgacaaggaacagctccgagcactttgcacccgggacccactg
tctgaaatcactgaacaagagaaagacttcctatggagccacagacactactgtgtaact
attcctgaaatcctacccaaattgcttctgtctgtcaagtggaattccagagacgaagtg
gcccagatgtactgcttagtaaaagattggcctccaatcaaaccggagcaagccatggag
ctcctggactgtaactatccagatcctatggttcggagttttgctgttcggtgcttggaa
aaatatttaacagatgacaaactgtctcagtacctcattcagcttgtacaggtcttaaaa
tatgaacaatatttggataacctgcttgtgagatttttactgaagaaagcattgacaaat
caaagaattggccattttttcttttggcatttaaaatctgagatgcacaataagactgtc
agtcagaggtttggcctgctactggagtcctactgccgtgcctgtgggatgtatctgaag
cacctgaacagacaagtagaggccatggagaagctcatcaacctaacagatatcctgaag
caggagaagaaggatgagacacaaaaggtacagatgaagtttttggttgaacagatgaga
cagccagacttcatggatgctttgcagggttttctgtcccctctaaatcctgctcaccaa
ctaggaaacctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagctactgtttcagaacaatgagatcatc
tttaaaaacggcgatgacttacggcaagatatgttaacccttcagatcatccgaatcatg
gagaacatctggcagaaccaaggccttgaccttcgcatgctaccttatggctgtctatcc
attggggactgtgtgggtctcattgaggtggtgagaaactctcacacaatcatgcaaatc
cagtgcaaaggaggcctgaagggggcgctgcagttcaacagccacacactgcatcagtgg
ctcaaggacaagaacaagggcgagatatatgatgcagccattgacctgttcactcggtcc
tgcgctgggtactgcgtggcaacctttatcttgggaattggagaccggcacaacagcaac
atcatggtgaaagatgacggacagctgtttcatatagattttgggcactttttggatcac
aagaagaaaaaatttggctataaacgggaacgtgtgccatttgttttgacgcaggatttc
ttgattgtgattagtaaaggagcacaagagtacacaaagaccagagagtttgagaggttt
caggagatgtgttacaaggcttacctagcaattcggcagcatgccaatctcttcatcaat
cttttttcaatgatgcttggctctggaatgccagaactgcaatcttttgatgacattgca
tatatccgaaagactctagccttggacaaaactgaacaagaagctttggaatatttcaca
aagcaaatgaatgatgcacatcatggtggatggacgacaaaaatggattggatcttccac
accatcaagcagcatgcattgaactga

KEGG   Mus pahari (shrew mouse): 110322865
Entry
110322865         CDS       T05929                                 

Gene name
Pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110322865 (Pik3r3)
   04014 Ras signaling pathway
    110322865 (Pik3r3)
   04015 Rap1 signaling pathway
    110322865 (Pik3r3)
   04370 VEGF signaling pathway
    110322865 (Pik3r3)
   04630 JAK-STAT signaling pathway
    110322865 (Pik3r3)
   04668 TNF signaling pathway
    110322865 (Pik3r3)
   04066 HIF-1 signaling pathway
    110322865 (Pik3r3)
   04068 FoxO signaling pathway
    110322865 (Pik3r3)
   04070 Phosphatidylinositol signaling system
    110322865 (Pik3r3)
   04072 Phospholipase D signaling pathway
    110322865 (Pik3r3)
   04071 Sphingolipid signaling pathway
    110322865 (Pik3r3)
   04024 cAMP signaling pathway
    110322865 (Pik3r3)
   04151 PI3K-Akt signaling pathway
    110322865 (Pik3r3)
   04152 AMPK signaling pathway
    110322865 (Pik3r3)
   04150 mTOR signaling pathway
    110322865 (Pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110322865 (Pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    110322865 (Pik3r3)
   04218 Cellular senescence
    110322865 (Pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110322865 (Pik3r3)
   04550 Signaling pathways regulating pluripotency of stem cells
    110322865 (Pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110322865 (Pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110322865 (Pik3r3)
   04613 Neutrophil extracellular trap formation
    110322865 (Pik3r3)
   04620 Toll-like receptor signaling pathway
    110322865 (Pik3r3)
   04625 C-type lectin receptor signaling pathway
    110322865 (Pik3r3)
   04650 Natural killer cell mediated cytotoxicity
    110322865 (Pik3r3)
   04660 T cell receptor signaling pathway
    110322865 (Pik3r3)
   04662 B cell receptor signaling pathway
    110322865 (Pik3r3)
   04664 Fc epsilon RI signaling pathway
    110322865 (Pik3r3)
   04666 Fc gamma R-mediated phagocytosis
    110322865 (Pik3r3)
   04670 Leukocyte transendothelial migration
    110322865 (Pik3r3)
   04062 Chemokine signaling pathway
    110322865 (Pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110322865 (Pik3r3)
   04923 Regulation of lipolysis in adipocytes
    110322865 (Pik3r3)
   04929 GnRH secretion
    110322865 (Pik3r3)
   04915 Estrogen signaling pathway
    110322865 (Pik3r3)
   04914 Progesterone-mediated oocyte maturation
    110322865 (Pik3r3)
   04917 Prolactin signaling pathway
    110322865 (Pik3r3)
   04926 Relaxin signaling pathway
    110322865 (Pik3r3)
   04935 Growth hormone synthesis, secretion and action
    110322865 (Pik3r3)
   04919 Thyroid hormone signaling pathway
    110322865 (Pik3r3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110322865 (Pik3r3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110322865 (Pik3r3)
  09156 Nervous system
   04725 Cholinergic synapse
    110322865 (Pik3r3)
   04722 Neurotrophin signaling pathway
    110322865 (Pik3r3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110322865 (Pik3r3)
  09158 Development and regeneration
   04360 Axon guidance
    110322865 (Pik3r3)
   04380 Osteoclast differentiation
    110322865 (Pik3r3)
  09149 Aging
   04211 Longevity regulating pathway
    110322865 (Pik3r3)
   04213 Longevity regulating pathway - multiple species
    110322865 (Pik3r3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322865 (Pik3r3)
   05206 MicroRNAs in cancer
    110322865 (Pik3r3)
   05205 Proteoglycans in cancer
    110322865 (Pik3r3)
   05203 Viral carcinogenesis
    110322865 (Pik3r3)
   05230 Central carbon metabolism in cancer
    110322865 (Pik3r3)
   05231 Choline metabolism in cancer
    110322865 (Pik3r3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110322865 (Pik3r3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110322865 (Pik3r3)
   05212 Pancreatic cancer
    110322865 (Pik3r3)
   05225 Hepatocellular carcinoma
    110322865 (Pik3r3)
   05226 Gastric cancer
    110322865 (Pik3r3)
   05214 Glioma
    110322865 (Pik3r3)
   05221 Acute myeloid leukemia
    110322865 (Pik3r3)
   05220 Chronic myeloid leukemia
    110322865 (Pik3r3)
   05218 Melanoma
    110322865 (Pik3r3)
   05211 Renal cell carcinoma
    110322865 (Pik3r3)
   05215 Prostate cancer
    110322865 (Pik3r3)
   05213 Endometrial cancer
    110322865 (Pik3r3)
   05224 Breast cancer
    110322865 (Pik3r3)
   05222 Small cell lung cancer
    110322865 (Pik3r3)
   05223 Non-small cell lung cancer
    110322865 (Pik3r3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110322865 (Pik3r3)
   05017 Spinocerebellar ataxia
    110322865 (Pik3r3)
   05020 Prion disease
    110322865 (Pik3r3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110322865 (Pik3r3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110322865 (Pik3r3)
   04932 Non-alcoholic fatty liver disease
    110322865 (Pik3r3)
   04931 Insulin resistance
    110322865 (Pik3r3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322865 (Pik3r3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110322865 (Pik3r3)
   05100 Bacterial invasion of epithelial cells
    110322865 (Pik3r3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322865 (Pik3r3)
   05170 Human immunodeficiency virus 1 infection
    110322865 (Pik3r3)
   05161 Hepatitis B
    110322865 (Pik3r3)
   05160 Hepatitis C
    110322865 (Pik3r3)
   05171 Coronavirus disease - COVID-19
    110322865 (Pik3r3)
   05164 Influenza A
    110322865 (Pik3r3)
   05162 Measles
    110322865 (Pik3r3)
   05168 Herpes simplex virus 1 infection
    110322865 (Pik3r3)
   05163 Human cytomegalovirus infection
    110322865 (Pik3r3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322865 (Pik3r3)
   05169 Epstein-Barr virus infection
    110322865 (Pik3r3)
   05165 Human papillomavirus infection
    110322865 (Pik3r3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110322865 (Pik3r3)
   05142 Chagas disease
    110322865 (Pik3r3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110322865 (Pik3r3)
   01524 Platinum drug resistance
    110322865 (Pik3r3)
   01522 Endocrine resistance
    110322865 (Pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110322865 (Pik3r3)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110322865 (Pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Bap31_Bap29_C Transcrip_act Cupin_8 Mod_r Fez1
Other DBs
NCBI-GeneID: 110322865
NCBI-ProteinID: XP_021055391
Ensembl: MGP_PahariEiJ_G0028661 MGP_PahariEiJ_G0028662
LinkDB
Position
6
AA seq 502 aa
MGPSQPVRAPRPPGLSSPYRRPGMGGPRRRCLSMFKCSRRTYRQKPRGPTATSPASVATN
ISDTDTTTSVLILSPRALPPKPPKPMTSAVTNGMKDSFVSLQDAEWYWGDISREEVNDKL
RDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSEPLTFTSVVELINH
YHHESLAQYNPKLDVKLTYPVSRYQQDQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLY
EEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDYIERFRREGNEKEIERIMMN
YDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHR
GVRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFVEDINRVQAEDLLYGKPDGA
FLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYSSLKELVLHYQQTSLVQ
HNDSLNVRLTYPVHAQMPTLCR
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggggccttctcagcctgttcgagcccctcggcctccgggcttgagttctccctaccga
aggccagggatgggtgggcccaggcgccggtgtctgagtatgttcaagtgtagccgcaga
acataccggcagaaaccccgaggcccaactgccaccagtcctgcctctgtggccacaaac
atcagtgacacggacactaccaccagtgtgttgattctgtcacctcgagctcttccacca
aagccacctaagccaatgacttcagcagttacaaatggaatgaaggacagtttcgtttct
cttcaagatgcagagtggtactggggagacatttccagggaagaggtaaatgacaaattg
cgggacatgccagatggtaccttcttagttcgtgatgcctcaacgaaaatgcagggggat
tatacattgactttgaggaagggaggaaataataaattaataaagatctatcatcgggat
ggtaaatatggcttctctgagcccctgacgtttacttctgtggtggagctcattaaccac
tatcaccatgagtctcttgctcagtacaatcccaaactcgacgtgaagctgacgtaccca
gtatccagataccaacaggatcagttggtaaaagaagacaacattgatgcagtaggtaaa
aatctgcaagagttccactctcagtatcaggagaagagcaaagagtacgacaggctgtac
gaagagtatacgaggacatcgcaggaaatacaaatgaagaggactgccattgaagccttt
aatgaaacaattaaaatatttgaggagcagtgtcatacccaagaacaacacagtaaagac
tatattgagcggtttcgcagagaggggaatgagaaggagattgagcgaattatgatgaat
tatgataaattgaaatcacgtcttggtgagattcatgatagcaaagtgcgtcttgagcag
gacttgaagaaacaagctttggacaaccgggaaattgataaaaaaatgaatagcatcaaa
cccgacctgattcagctgcgtaagatccgagatcagcaccttgtatggctcaatcacaga
ggagtgaggcagaggcgcctgaatgcctggctggggatcaagaatgaggactcggatgaa
agctattttatcaatgaggaagatgagaacctgccgcattatgatgagaaaacctggttt
gtggaggatatcaaccgagtacaagcagaggacttgctttatgggaaaccagatggtgca
ttcttaattcgtgagagtagcaagaaaggatgttacgcttgttctgtggttgcagacggg
gaagtgaagcactgtgtcatctacagcacggctcgaggatatggctttgcagaaccctac
aacctgtacagctcactgaaggagctggtgctccattaccagcagacatccctggttcag
cacaacgactccctcaacgtcaggctcacctaccctgtccatgcacagatgcctacactc
tgcagataa

KEGG   Mus pahari (shrew mouse): 110323448
Entry
110323448         CDS       T05929                                 

Gene name
Pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110323448 (Pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110323448 (Pik3cd)
   04014 Ras signaling pathway
    110323448 (Pik3cd)
   04015 Rap1 signaling pathway
    110323448 (Pik3cd)
   04370 VEGF signaling pathway
    110323448 (Pik3cd)
   04630 JAK-STAT signaling pathway
    110323448 (Pik3cd)
   04668 TNF signaling pathway
    110323448 (Pik3cd)
   04066 HIF-1 signaling pathway
    110323448 (Pik3cd)
   04068 FoxO signaling pathway
    110323448 (Pik3cd)
   04070 Phosphatidylinositol signaling system
    110323448 (Pik3cd)
   04072 Phospholipase D signaling pathway
    110323448 (Pik3cd)
   04071 Sphingolipid signaling pathway
    110323448 (Pik3cd)
   04024 cAMP signaling pathway
    110323448 (Pik3cd)
   04151 PI3K-Akt signaling pathway
    110323448 (Pik3cd)
   04152 AMPK signaling pathway
    110323448 (Pik3cd)
   04150 mTOR signaling pathway
    110323448 (Pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110323448 (Pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    110323448 (Pik3cd)
   04218 Cellular senescence
    110323448 (Pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110323448 (Pik3cd)
   04550 Signaling pathways regulating pluripotency of stem cells
    110323448 (Pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110323448 (Pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110323448 (Pik3cd)
   04613 Neutrophil extracellular trap formation
    110323448 (Pik3cd)
   04620 Toll-like receptor signaling pathway
    110323448 (Pik3cd)
   04625 C-type lectin receptor signaling pathway
    110323448 (Pik3cd)
   04650 Natural killer cell mediated cytotoxicity
    110323448 (Pik3cd)
   04660 T cell receptor signaling pathway
    110323448 (Pik3cd)
   04662 B cell receptor signaling pathway
    110323448 (Pik3cd)
   04664 Fc epsilon RI signaling pathway
    110323448 (Pik3cd)
   04666 Fc gamma R-mediated phagocytosis
    110323448 (Pik3cd)
   04670 Leukocyte transendothelial migration
    110323448 (Pik3cd)
   04062 Chemokine signaling pathway
    110323448 (Pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110323448 (Pik3cd)
   04923 Regulation of lipolysis in adipocytes
    110323448 (Pik3cd)
   04929 GnRH secretion
    110323448 (Pik3cd)
   04915 Estrogen signaling pathway
    110323448 (Pik3cd)
   04914 Progesterone-mediated oocyte maturation
    110323448 (Pik3cd)
   04917 Prolactin signaling pathway
    110323448 (Pik3cd)
   04926 Relaxin signaling pathway
    110323448 (Pik3cd)
   04935 Growth hormone synthesis, secretion and action
    110323448 (Pik3cd)
   04919 Thyroid hormone signaling pathway
    110323448 (Pik3cd)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110323448 (Pik3cd)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110323448 (Pik3cd)
  09156 Nervous system
   04725 Cholinergic synapse
    110323448 (Pik3cd)
   04722 Neurotrophin signaling pathway
    110323448 (Pik3cd)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110323448 (Pik3cd)
  09158 Development and regeneration
   04360 Axon guidance
    110323448 (Pik3cd)
   04380 Osteoclast differentiation
    110323448 (Pik3cd)
  09149 Aging
   04211 Longevity regulating pathway
    110323448 (Pik3cd)
   04213 Longevity regulating pathway - multiple species
    110323448 (Pik3cd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323448 (Pik3cd)
   05206 MicroRNAs in cancer
    110323448 (Pik3cd)
   05205 Proteoglycans in cancer
    110323448 (Pik3cd)
   05203 Viral carcinogenesis
    110323448 (Pik3cd)
   05230 Central carbon metabolism in cancer
    110323448 (Pik3cd)
   05231 Choline metabolism in cancer
    110323448 (Pik3cd)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110323448 (Pik3cd)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110323448 (Pik3cd)
   05212 Pancreatic cancer
    110323448 (Pik3cd)
   05225 Hepatocellular carcinoma
    110323448 (Pik3cd)
   05226 Gastric cancer
    110323448 (Pik3cd)
   05214 Glioma
    110323448 (Pik3cd)
   05221 Acute myeloid leukemia
    110323448 (Pik3cd)
   05220 Chronic myeloid leukemia
    110323448 (Pik3cd)
   05218 Melanoma
    110323448 (Pik3cd)
   05211 Renal cell carcinoma
    110323448 (Pik3cd)
   05215 Prostate cancer
    110323448 (Pik3cd)
   05213 Endometrial cancer
    110323448 (Pik3cd)
   05224 Breast cancer
    110323448 (Pik3cd)
   05222 Small cell lung cancer
    110323448 (Pik3cd)
   05223 Non-small cell lung cancer
    110323448 (Pik3cd)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323448 (Pik3cd)
   05017 Spinocerebellar ataxia
    110323448 (Pik3cd)
   05020 Prion disease
    110323448 (Pik3cd)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110323448 (Pik3cd)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110323448 (Pik3cd)
   04932 Non-alcoholic fatty liver disease
    110323448 (Pik3cd)
   04931 Insulin resistance
    110323448 (Pik3cd)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110323448 (Pik3cd)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110323448 (Pik3cd)
   05135 Yersinia infection
    110323448 (Pik3cd)
   05100 Bacterial invasion of epithelial cells
    110323448 (Pik3cd)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110323448 (Pik3cd)
   05170 Human immunodeficiency virus 1 infection
    110323448 (Pik3cd)
   05161 Hepatitis B
    110323448 (Pik3cd)
   05160 Hepatitis C
    110323448 (Pik3cd)
   05171 Coronavirus disease - COVID-19
    110323448 (Pik3cd)
   05164 Influenza A
    110323448 (Pik3cd)
   05162 Measles
    110323448 (Pik3cd)
   05168 Herpes simplex virus 1 infection
    110323448 (Pik3cd)
   05163 Human cytomegalovirus infection
    110323448 (Pik3cd)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323448 (Pik3cd)
   05169 Epstein-Barr virus infection
    110323448 (Pik3cd)
   05165 Human papillomavirus infection
    110323448 (Pik3cd)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110323448 (Pik3cd)
   05142 Chagas disease
    110323448 (Pik3cd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110323448 (Pik3cd)
   01524 Platinum drug resistance
    110323448 (Pik3cd)
   01522 Endocrine resistance
    110323448 (Pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323448 (Pik3cd)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110323448 (Pik3cd)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110323448 (Pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2
Other DBs
NCBI-GeneID: 110323448
NCBI-ProteinID: XP_021056325
Ensembl: MGP_PahariEiJ_G0029168
LinkDB
Position
6
AA seq 1047 aa
MPPGVDCPMEFWTKEESQNVVVDFLLPTGVYLNFPVSRNANLSTIKQVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSARGWRA
GLLRVSNRALLVNVKFEGSEESFTFQVATKDMPLALMACALRKKATVFRQPLVEQPEEYA
LQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
AKPPPIPAKKPSSVSLWSLEQPFCIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSS
SEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGTVRGNPNTESAVALVICLPEVAP
HPVYFPALEKILELGRHGERGRITEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
HFPEALARLLLVTKWNKHEDVAQLSQMIHLLCSWPELPVLSALELLDFSFPDCYVGSFAI
KSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHV
PSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHM
CMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIM
FKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANI
QLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSD
NIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFR
GYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRV
KFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgccccctggggtggactgccccatggagttctggaccaaagaggagagccagaacgtg
gttgttgacttcttgctgcccacaggagtctacttgaacttcccggtgtcccgcaatgcc
aacctcagcaccatcaagcaggtgctgtggcaccgtgcacagtatgagccactcttccac
atgctcagtgaccccgaggcctatgtgttcacctgtgtgaaccagacggcggagcagcag
gagttggaggatgagcagcggaggctgtgtgacatccagcccttcctgcccgtgctgcgc
ctcgtagcccgagagggggaccgcgtgaagaagctcattaactctcagatcagcctcctc
attggcaaaggtctccatgagtttgattccctgcgggacccggaagtaaacgacttccgc
actaagatgcgccagttttgtgaagaggctgcggctcaccgccagcagctgggctgggtg
gaatggctgcagtatagcttccccctgcagctggagccctcagcgaggggttggcgggcc
ggcttactgcgtgtcagcaaccgagccctgctggtcaacgtgaagttcgagggcagtgag
gagagcttcaccttccaggtagccaccaaggacatgcccctggcactgatggcctgtgcc
ctccgaaaaaaggccacggtgttccggcagcctctggtggagcagcctgaggaatatgcc
ctgcaggtgaatgggaggcacgaatacctctatggcaactaccctctctgccactttcag
tacatctgcagctgcctgcacagtgggctgactccccatctgaccatggtccactcctcc
tccatccttgctatgcgggatgagcagagcaatcctgccccccaagtgcagaaaccacgt
gccaaacctcccccgatccctgccaagaagccctcctctgtgtccctgtggtccctggaa
cagccattctgcattgagctgatcgagggccgaaaagtgaatgcggacgagcggatgaag
ctggttgtgcaggccgggctcttccatggcaatgagatgctgtgcaagaccgtgtccagc
tcggaggtgaatgtgtgctcagagcctgtgtggaagcagcgactggagttcgatatcagc
gtctgtgacctccctcgcatggctcgactctgttttgctctctatgctgtcgtggagaag
gctaagaaggcgcgctccacaaagaagaagtctaagaaggcggactgccccatcgcttgg
gccaacctcatgttattcgactacaaagatcagctcaagacgggggaacgctgcctctac
atgtggccctctgtcccagatgaaaagggggagctgctgaatcctgcgggtacagtacgc
gggaaccccaacacggagagtgccgttgccctggtcatctgcctgcctgaggtggccccc
caccccgtgtacttccctgctctggagaagatcctggagctggggcgtcatggggagcgt
gggcgcatcacagaagaggagcagctgcagctgcgggagatcctggagcggcggggatcc
ggggaactgtacgagcatgagaaggacctggtgtggaagatgcgccatgaagtccaggag
catttcccagaggcactggcccgcctgctactggtcaccaagtggaataaacatgaggat
gtggcccagctgtcccagatgatccatttgctgtgttcctggcccgagctgcctgtgctg
agcgccctggaacttctggactttagctttcccgactgctacgtgggctccttcgccatc
aagtccctacggaagctgacggacgacgagcttttccagtaccttctgcagctggtgcaa
gtgctcaaatacgagtcctacctggactgcgagttgaccaaattcttgctgggccgagcc
ctggctaaccgcaagatcgggcacttcctgttctggcacctccgctcagagatgcatgta
ccatcagtggccctgcggtttggtctcatcatggaagcctactgcagaggcagcacccac
cacatgaaggtgctgatgaagcagggggaagcactgagcaagctgaaggcactgaatgac
tttgtgaaggtgagctcccagaagaccaccaagccccaaaccaaggagatgatgcatatg
tgcatgcgccaggagacctacatggaggccctgtcccacctgcagtctccgctcgacccc
agcaccctgctggaggaagtctgtgtggagcagtgcaccttcatggactccaaaatgaag
ccgttgtggatcatgtacagcagtgaagaggcgggcagtgctggcaacgtgggcatcatg
tttaagaacggggatgacctccgccaggacatgctgactctgcagatgatccagctcatg
gacgtcctgtggaagcaggagggcctggatctgaggatgacgccctatggctgcctcccc
accggggaccgcacaggtctcattgaggtggtcctccactcagacaccatcgccaacatc
cagctcaacaagagcaacatggcggccacagctgccttcaacaaggatgccctgctcaac
tggctcaagtccaagaaccctggggaggccctggatcgggccattgaggaattcaccctc
tcctgtgctggctactgtgtggccacgtatgtgctgggcatcggtgaccggcacagcgac
aacatcatgatcagagagagtgggcagctcttccacattgattttggccactttctgggg
aacttcaagaccaagttcggaatcaaccgggagcgcgtccccttcattctcacctatgac
tttgtccacgtgatccagcaggggaagactaacaacagtgagaagtttgaaaggttccga
ggctactgtgaacgagcctacaccatcctgcggcgccacgggctgcttttcctccatctc
ttcgccctgatgcgggccgcaggtctgcctgagcttagctgctccaaagacatccagtac
ctcaaggactctctggcactggggaagacggaggaagaggcgctaaagcacttccgggtg
aagttcaacgaagctctccgagagagctggaaaaccaaagtcaactggctggcgcacaat
gtgtccaaggataacagacagtaa

KEGG   Mus pahari (shrew mouse): 110327251
Entry
110327251         CDS       T05929                                 

Gene name
Pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00562  Inositol phosphate metabolism
mpah01100  Metabolic pathways
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    110327251 (Pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110327251 (Pik3cb)
   04014 Ras signaling pathway
    110327251 (Pik3cb)
   04015 Rap1 signaling pathway
    110327251 (Pik3cb)
   04370 VEGF signaling pathway
    110327251 (Pik3cb)
   04630 JAK-STAT signaling pathway
    110327251 (Pik3cb)
   04668 TNF signaling pathway
    110327251 (Pik3cb)
   04066 HIF-1 signaling pathway
    110327251 (Pik3cb)
   04068 FoxO signaling pathway
    110327251 (Pik3cb)
   04070 Phosphatidylinositol signaling system
    110327251 (Pik3cb)
   04072 Phospholipase D signaling pathway
    110327251 (Pik3cb)
   04071 Sphingolipid signaling pathway
    110327251 (Pik3cb)
   04024 cAMP signaling pathway
    110327251 (Pik3cb)
   04151 PI3K-Akt signaling pathway
    110327251 (Pik3cb)
   04152 AMPK signaling pathway
    110327251 (Pik3cb)
   04150 mTOR signaling pathway
    110327251 (Pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110327251 (Pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    110327251 (Pik3cb)
   04218 Cellular senescence
    110327251 (Pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110327251 (Pik3cb)
   04550 Signaling pathways regulating pluripotency of stem cells
    110327251 (Pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110327251 (Pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110327251 (Pik3cb)
   04613 Neutrophil extracellular trap formation
    110327251 (Pik3cb)
   04620 Toll-like receptor signaling pathway
    110327251 (Pik3cb)
   04625 C-type lectin receptor signaling pathway
    110327251 (Pik3cb)
   04650 Natural killer cell mediated cytotoxicity
    110327251 (Pik3cb)
   04660 T cell receptor signaling pathway
    110327251 (Pik3cb)
   04662 B cell receptor signaling pathway
    110327251 (Pik3cb)
   04664 Fc epsilon RI signaling pathway
    110327251 (Pik3cb)
   04666 Fc gamma R-mediated phagocytosis
    110327251 (Pik3cb)
   04670 Leukocyte transendothelial migration
    110327251 (Pik3cb)
   04062 Chemokine signaling pathway
    110327251 (Pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110327251 (Pik3cb)
   04923 Regulation of lipolysis in adipocytes
    110327251 (Pik3cb)
   04929 GnRH secretion
    110327251 (Pik3cb)
   04915 Estrogen signaling pathway
    110327251 (Pik3cb)
   04914 Progesterone-mediated oocyte maturation
    110327251 (Pik3cb)
   04917 Prolactin signaling pathway
    110327251 (Pik3cb)
   04926 Relaxin signaling pathway
    110327251 (Pik3cb)
   04935 Growth hormone synthesis, secretion and action
    110327251 (Pik3cb)
   04919 Thyroid hormone signaling pathway
    110327251 (Pik3cb)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110327251 (Pik3cb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110327251 (Pik3cb)
  09156 Nervous system
   04725 Cholinergic synapse
    110327251 (Pik3cb)
   04722 Neurotrophin signaling pathway
    110327251 (Pik3cb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110327251 (Pik3cb)
  09158 Development and regeneration
   04360 Axon guidance
    110327251 (Pik3cb)
   04380 Osteoclast differentiation
    110327251 (Pik3cb)
  09149 Aging
   04211 Longevity regulating pathway
    110327251 (Pik3cb)
   04213 Longevity regulating pathway - multiple species
    110327251 (Pik3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327251 (Pik3cb)
   05206 MicroRNAs in cancer
    110327251 (Pik3cb)
   05205 Proteoglycans in cancer
    110327251 (Pik3cb)
   05203 Viral carcinogenesis
    110327251 (Pik3cb)
   05230 Central carbon metabolism in cancer
    110327251 (Pik3cb)
   05231 Choline metabolism in cancer
    110327251 (Pik3cb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110327251 (Pik3cb)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110327251 (Pik3cb)
   05212 Pancreatic cancer
    110327251 (Pik3cb)
   05225 Hepatocellular carcinoma
    110327251 (Pik3cb)
   05226 Gastric cancer
    110327251 (Pik3cb)
   05214 Glioma
    110327251 (Pik3cb)
   05221 Acute myeloid leukemia
    110327251 (Pik3cb)
   05220 Chronic myeloid leukemia
    110327251 (Pik3cb)
   05218 Melanoma
    110327251 (Pik3cb)
   05211 Renal cell carcinoma
    110327251 (Pik3cb)
   05215 Prostate cancer
    110327251 (Pik3cb)
   05213 Endometrial cancer
    110327251 (Pik3cb)
   05224 Breast cancer
    110327251 (Pik3cb)
   05222 Small cell lung cancer
    110327251 (Pik3cb)
   05223 Non-small cell lung cancer
    110327251 (Pik3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110327251 (Pik3cb)
   05017 Spinocerebellar ataxia
    110327251 (Pik3cb)
   05020 Prion disease
    110327251 (Pik3cb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110327251 (Pik3cb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110327251 (Pik3cb)
   04932 Non-alcoholic fatty liver disease
    110327251 (Pik3cb)
   04931 Insulin resistance
    110327251 (Pik3cb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110327251 (Pik3cb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110327251 (Pik3cb)
   05135 Yersinia infection
    110327251 (Pik3cb)
   05100 Bacterial invasion of epithelial cells
    110327251 (Pik3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110327251 (Pik3cb)
   05170 Human immunodeficiency virus 1 infection
    110327251 (Pik3cb)
   05161 Hepatitis B
    110327251 (Pik3cb)
   05160 Hepatitis C
    110327251 (Pik3cb)
   05171 Coronavirus disease - COVID-19
    110327251 (Pik3cb)
   05164 Influenza A
    110327251 (Pik3cb)
   05162 Measles
    110327251 (Pik3cb)
   05168 Herpes simplex virus 1 infection
    110327251 (Pik3cb)
   05163 Human cytomegalovirus infection
    110327251 (Pik3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110327251 (Pik3cb)
   05169 Epstein-Barr virus infection
    110327251 (Pik3cb)
   05165 Human papillomavirus infection
    110327251 (Pik3cb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110327251 (Pik3cb)
   05142 Chagas disease
    110327251 (Pik3cb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110327251 (Pik3cb)
   01524 Platinum drug resistance
    110327251 (Pik3cb)
   01522 Endocrine resistance
    110327251 (Pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110327251 (Pik3cb)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     110327251 (Pik3cb)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110327251 (Pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_rbd PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 110327251
NCBI-ProteinID: XP_021061719
Ensembl: MGP_PahariEiJ_G0015427
LinkDB
Position
10
AA seq 1064 aa
MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREATISYIKQMLWKQVHNY
PMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPAEKLDSKI
GVLIGKGLHEFDALKDPEVNEFRRKMRKFSEDKIQSLVGLSWIDWLKHTYPPEHEPSVLE
NLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAIQKRLTIRGKEDEASPCDY
VLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECCKIKKMYEQEMIAIEAAINR
NSSNLPLPLPPKKTRVISHVWDNNNPFQIILVKGNKLNTEETVKVHVRAGIFHGTELLCK
TVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVYAVLDKVKTKKSTKTINPSKYQ
TIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSSFPDELEEMLNPMGTVQTNPYAE
NATALHIKFPENKKQPYYYPPFDKIIEKAAELASGDSANVSSRGGKKFLAVLKEILDRDP
LSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPKLPPREA
LELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLLERALD
NRRIGQFLFWHLRSEVHTPAVSIQFGVILEAYCRGSVGHMKVLSKQVEALNKLKTLNSLI
KLNAMKLNRAKGKEAMHTCLKQSAYREALSDLQSPLNPCVILSELYVEKCKYMDSKMKPL
WLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGD
RSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA
GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFILTYDFIH
VIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDIQYLKD
SLALGKTEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgcctcctgctatggcagacaaccttgacatctgggcagtggactcacagattgcatcc
gatggcgccatatccgtcgatttccttctgcccaccgggatttatatccagttggaagta
cctcgggaggctaccatttcttatattaaacagatgttatggaagcaagttcacaactac
ccgatgtttaacctcctcatggacattgactcctatatgtttgcatgtgtgaatcaaact
gccgtatatgaggaactggaagacgaaacacgaagactttgtgatgtcagaccttttctt
ccagttctcaaactagtgactagaagctgtgacccagcagaaaaattggactcaaaaatt
ggagttcttataggaaaaggtcttcatgagtttgatgccttgaaggatcccgaagtgaat
gaatttagaagaaaaatgcgcaaattcagtgaggacaagattcagtctctagtggggttg
tcttggattgactggctaaagcacacgtatccacctgagcatgagccgtctgtcctggag
aacttggaagataaactttatggaggaaagctggttgtagctgtgcactttgaaaatagc
caggatgtatttagttttcaagtgtctcccaatttgaatcctataaaaataaatgaattg
gcaatccagaaacgcctcactattcgtggaaaggaagatgaagctagcccctgtgactat
gtgttacaggtcagtgggagagtggagtatgtgtttggcgatcatccactaattcagttc
cagtacatccggaattgtgtgatgaataggaccctgccccacttcatccttgtggaatgt
tgtaagatcaagaaaatgtatgaacaagaaatgattgccatagaggctgccatcaaccga
aactcatccaaccttcctctccctttaccaccaaagaaaacacgagttatttctcatgtc
tgggacaacaacaaccctttccaaattatcttggtaaaaggaaataagcttaatacagaa
gaaactgtgaaagtccatgtccgagctgggatttttcacggaaccgagctcctgtgtaaa
accgtcgtaagctcggagatatcagggaagaacgaccatatttggaatgaacaactggaa
tttgatattaatatttgcgacttaccaagaatggctcgattatgttttgctgtttacgca
gttttggataaagtaaaaacgaagaaatcaacaaaaactattaatccctctaaatatcag
accatcaggaaagctgggaaagtgcattatcctgtcgcgtgggtaaataccatggttttt
gacttcaaaggacagctgaggtctggagacgtcatattgcacagctggtcttcgtttcct
gatgagctggaagaaatgctaaatcctatggggactgtgcagacgaacccgtatgctgag
aatgctactgccttgcatattaagttcccagagaataagaagcagccttattattacccc
cccttcgataagatcattgagaaggcagctgaacttgccagcggagacagtgctaatgtg
tcaagtcgtggtgggaaaaaatttcttgctgtactgaaagaaatcttggacagggacccc
ctgtctcagctgtgtgagaacgaaatggaccttatttggactctacggcaagactgccga
gaaaatttccctcagtcactgccaaaactcctcctgtcaatcaagtggaataaacttgaa
gatgttgctcagcttcaggcgctcctgcagatttggcccaaactgccccccagggaagcc
ctggaactcctggatttcaactatccagaccagtatgtccgggaatacgctgtcggctgc
ctccgacagatgagtgatgaagaactctctcagtatcttttacaattggtgcaagttttg
aaatatgagccttttcttgattgtgccctctccagattcctattagaaagagcacttgat
aatcggagaattgggcagttcctattttggcatcttaggtcagaggtgcacactcctgct
gtgtccatacagtttggtgtcattctggaagcatactgtcgaggaagtgtggggcacatg
aaagtgctttccaaacaggtcgaagcactcaataagttaaaaactttaaatagtttaatc
aaactgaatgccatgaagctgaacagagctaaaggaaaggaggccatgcacacgtgctta
aaacagagtgcttaccgggaggcgctctcggacctgcagtcgccgctgaacccgtgcgtt
atcctctcagagctctatgttgaaaagtgcaaatacatggactccaagatgaagcccctg
tggctggtctacagcagcagagcctttggagaggactcggttggagtgatctttaaaaat
ggtgacgatttgcggcaggacatgctgacgctgcagatgctgcgcctgatggatctgcta
tggaaagaagctggcttggacctgcggatgctcccctacggctgtttagcaacaggagat
cgctctggcctcattgaggttgtgagcacctctgagacaatcgctgacattcagctgaac
agtagtaatgtggctgccacagcagccttcaacaaagacgcactcctgaactggctcaag
gagtacaactctggggatgacctggaccgagcaattgaggagttcaccttgtcctgtgct
ggctactgtgtagcctcttatgtcctcggcattggtgacaggcacagcgacaacatcatg
gtgaagaaaacgggccagctcttccacatagattttgggcatattcttggaaatttcaaa
tctaaatttggcattaaaagggagcgagtaccttttattcttacttacgacttcattcat
gtcattcaacaaggaaaaactggaaacactgaaaaatttggcaggttccgccagtgctgt
gaagatgcgtacctgattttacggcggcatgggaacctcttcatcaccctgtttgcgctg
atgttgactgcagggctgcccgagctcacgtcggtcaaagatatacagtatcttaaggac
tctcttgccttagggaagactgaggaggaagcactgaagcagttcaagcagaagtttgac
gaggccctcagggaaagctggactactaaagtgaactggatggctcacacagtgcggaaa
gactacaggtcttag

KEGG   Mus pahari (shrew mouse): 110328811
Entry
110328811         CDS       T05929                                 

Gene name
Pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110328811 (Pik3r1)
   04014 Ras signaling pathway
    110328811 (Pik3r1)
   04015 Rap1 signaling pathway
    110328811 (Pik3r1)
   04370 VEGF signaling pathway
    110328811 (Pik3r1)
   04630 JAK-STAT signaling pathway
    110328811 (Pik3r1)
   04668 TNF signaling pathway
    110328811 (Pik3r1)
   04066 HIF-1 signaling pathway
    110328811 (Pik3r1)
   04068 FoxO signaling pathway
    110328811 (Pik3r1)
   04070 Phosphatidylinositol signaling system
    110328811 (Pik3r1)
   04072 Phospholipase D signaling pathway
    110328811 (Pik3r1)
   04071 Sphingolipid signaling pathway
    110328811 (Pik3r1)
   04024 cAMP signaling pathway
    110328811 (Pik3r1)
   04151 PI3K-Akt signaling pathway
    110328811 (Pik3r1)
   04152 AMPK signaling pathway
    110328811 (Pik3r1)
   04150 mTOR signaling pathway
    110328811 (Pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110328811 (Pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    110328811 (Pik3r1)
   04218 Cellular senescence
    110328811 (Pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110328811 (Pik3r1)
   04550 Signaling pathways regulating pluripotency of stem cells
    110328811 (Pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110328811 (Pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110328811 (Pik3r1)
   04613 Neutrophil extracellular trap formation
    110328811 (Pik3r1)
   04620 Toll-like receptor signaling pathway
    110328811 (Pik3r1)
   04625 C-type lectin receptor signaling pathway
    110328811 (Pik3r1)
   04650 Natural killer cell mediated cytotoxicity
    110328811 (Pik3r1)
   04660 T cell receptor signaling pathway
    110328811 (Pik3r1)
   04662 B cell receptor signaling pathway
    110328811 (Pik3r1)
   04664 Fc epsilon RI signaling pathway
    110328811 (Pik3r1)
   04666 Fc gamma R-mediated phagocytosis
    110328811 (Pik3r1)
   04670 Leukocyte transendothelial migration
    110328811 (Pik3r1)
   04062 Chemokine signaling pathway
    110328811 (Pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110328811 (Pik3r1)
   04923 Regulation of lipolysis in adipocytes
    110328811 (Pik3r1)
   04929 GnRH secretion
    110328811 (Pik3r1)
   04915 Estrogen signaling pathway
    110328811 (Pik3r1)
   04914 Progesterone-mediated oocyte maturation
    110328811 (Pik3r1)
   04917 Prolactin signaling pathway
    110328811 (Pik3r1)
   04926 Relaxin signaling pathway
    110328811 (Pik3r1)
   04935 Growth hormone synthesis, secretion and action
    110328811 (Pik3r1)
   04919 Thyroid hormone signaling pathway
    110328811 (Pik3r1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110328811 (Pik3r1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110328811 (Pik3r1)
  09156 Nervous system
   04725 Cholinergic synapse
    110328811 (Pik3r1)
   04722 Neurotrophin signaling pathway
    110328811 (Pik3r1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110328811 (Pik3r1)
  09158 Development and regeneration
   04360 Axon guidance
    110328811 (Pik3r1)
   04380 Osteoclast differentiation
    110328811 (Pik3r1)
  09149 Aging
   04211 Longevity regulating pathway
    110328811 (Pik3r1)
   04213 Longevity regulating pathway - multiple species
    110328811 (Pik3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110328811 (Pik3r1)
   05206 MicroRNAs in cancer
    110328811 (Pik3r1)
   05205 Proteoglycans in cancer
    110328811 (Pik3r1)
   05203 Viral carcinogenesis
    110328811 (Pik3r1)
   05230 Central carbon metabolism in cancer
    110328811 (Pik3r1)
   05231 Choline metabolism in cancer
    110328811 (Pik3r1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110328811 (Pik3r1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110328811 (Pik3r1)
   05212 Pancreatic cancer
    110328811 (Pik3r1)
   05225 Hepatocellular carcinoma
    110328811 (Pik3r1)
   05226 Gastric cancer
    110328811 (Pik3r1)
   05214 Glioma
    110328811 (Pik3r1)
   05221 Acute myeloid leukemia
    110328811 (Pik3r1)
   05220 Chronic myeloid leukemia
    110328811 (Pik3r1)
   05218 Melanoma
    110328811 (Pik3r1)
   05211 Renal cell carcinoma
    110328811 (Pik3r1)
   05215 Prostate cancer
    110328811 (Pik3r1)
   05213 Endometrial cancer
    110328811 (Pik3r1)
   05224 Breast cancer
    110328811 (Pik3r1)
   05222 Small cell lung cancer
    110328811 (Pik3r1)
   05223 Non-small cell lung cancer
    110328811 (Pik3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110328811 (Pik3r1)
   05017 Spinocerebellar ataxia
    110328811 (Pik3r1)
   05020 Prion disease
    110328811 (Pik3r1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110328811 (Pik3r1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110328811 (Pik3r1)
   04932 Non-alcoholic fatty liver disease
    110328811 (Pik3r1)
   04931 Insulin resistance
    110328811 (Pik3r1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110328811 (Pik3r1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110328811 (Pik3r1)
   05100 Bacterial invasion of epithelial cells
    110328811 (Pik3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110328811 (Pik3r1)
   05170 Human immunodeficiency virus 1 infection
    110328811 (Pik3r1)
   05161 Hepatitis B
    110328811 (Pik3r1)
   05160 Hepatitis C
    110328811 (Pik3r1)
   05171 Coronavirus disease - COVID-19
    110328811 (Pik3r1)
   05164 Influenza A
    110328811 (Pik3r1)
   05162 Measles
    110328811 (Pik3r1)
   05168 Herpes simplex virus 1 infection
    110328811 (Pik3r1)
   05163 Human cytomegalovirus infection
    110328811 (Pik3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110328811 (Pik3r1)
   05169 Epstein-Barr virus infection
    110328811 (Pik3r1)
   05165 Human papillomavirus infection
    110328811 (Pik3r1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110328811 (Pik3r1)
   05142 Chagas disease
    110328811 (Pik3r1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110328811 (Pik3r1)
   01524 Platinum drug resistance
    110328811 (Pik3r1)
   01522 Endocrine resistance
    110328811 (Pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110328811 (Pik3r1)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110328811 (Pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 Laminin_I Mod_r PI_PP_I Bap31_Bap29_C Transcrip_act
Other DBs
NCBI-GeneID: 110328811
NCBI-ProteinID: XP_021063932
Ensembl: MGP_PahariEiJ_G0015924
LinkDB
Position
11
AA seq 724 aa
MSAEAYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKRISPPTPKPRPPRPLPVAPGSSKTEADAEQQALTLPDLAE
QFAPPDVAPPLLIKLLEAIEKKGLECSTLYRAQSSSSPAELRQLLDCDAASVDLEMIDVH
VLADAFKRYLADLPNPVIPVAVYNEMMSLAQEVQSPEDCIQLLKKLIRSPSISHQCWLTL
QYLLKHFFKLSQASSKNLLNARVLSEIFSPVLFRFPAASSDNTEHLIKAIEILISTEWNE
RQPAPALPPKPPKPTTVANNSMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKL
DVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQRIMHNHDKLKSRISEIID
SRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
ENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYA
QQRR
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagtgcagaggcctaccagtacagagcactgtacgactacaagaaggagcgcgaggaa
gacatcgacctacacttgggggacatactgactgtgaataaaggctccttagtggcactt
ggattcagtgacggccaggaagcccggcctgaagagattggctggttaaatggctacaat
gaaaccactggggaaaggggagactttccaggaacttacgttgaatacattggaaggaaa
agaatttcaccccccactcccaagccacggccccctcgacctcttcctgttgctcccggt
tcttcaaaaactgaagcggacgcggagcagcaagcgttgacccttcctgatctggctgag
caatttgcccctcctgatgttgccccgcctctccttataaagctcctggaagccattgag
aagaaaggactggaatgttcaactctatacagagcacagagctccagcagccctgcagaa
ttacgacagcttcttgattgtgatgccgcctcagtggacttggagatgattgacgtacac
gttttagcggatgctttcaaacgctatctcgcggacttgccaaatcctgtcattcctgta
gctgtttacaatgagatgatgtctttagcccaagaagtacagagccctgaagactgcatc
cagctgttgaagaagctcatcaggtcgcctagtatatctcatcagtgttggcttacgctt
cagtatttgctcaagcattttttcaagctctctcaagcctccagcaaaaaccttttgaat
gcaagggtcctctctgagattttcagccccgtgcttttcagatttccagccgccagctct
gataatactgaacacctcataaaagcgatagagattttaatctcaacagaatggaatgag
agacagccagcaccagcactgccccccaaaccacccaagcccactactgtagccaacaac
agcatgaacaacaatatgtccttgcaggatgctgaatggtactggggagacatctcaagg
gaagaagtgaatgaaaaactccgagacactgctgatgggacctttttggtacgagatgca
tctactaagatgcacggcgattatactcttacactaaggaaaggaggaaataacaaatta
atcaaaatctttcaccgagatggaaaatatggcttctctgatccattaaccttcaactct
gtggttgaattaataaaccactaccggaatgagtctttagctcagtacaatcccaagctg
gatgtgaagttactctaccctgtgtccaaataccagcaggatcaagttgtcaaagaagat
aatattgaagctgtagggaaaaaattacatgaatataatactcaatttcaagaaaaaagt
cgggaatatgatagattatatgaggagtacacccgtacttcccaggaaattcaaatgaaa
agaacagctattgaagcatttaatgaaaccataaaaatatttgaagaacaatgccaaacc
caggagcggtacagcaaagagtacatagagaagtttaaacgcgaaggcaacgagaaagaa
attcaaaggatcatgcataaccatgataagctaaagtcacggatcagtgagatcattgac
agtaggaggaggttggaagaagacttgaagaagcaggcagccgagtatcgtgagatcgac
aaacgcatgaacagtattaagccggacctcatccagttgagaaagacaagagaccaatac
ttgatgtggctgacacagaaaggtgtgcggcagaagaagttgaacgagtggctggggaat
gaaaataccgaagaccaatactcactggtggaagatgacgaggacttgccccaccacgac
gagaagacgtggaatgtcgggagcagcaaccgaaacaaagcggagaacctacttcgaggg
aagcgagatggcactttccttgtccgggagagcagtaagcagggctgctatgcctgctcc
gtagtggtagacggcgaagtcaagcattgcgtcatcaacaagactgccaccggctatggc
tttgccgagccctacaacctgtacagctccctgaaggagctggtgctccattatcaacac
acttcccttgtgcagcacaatgactccctcaatgtcacactagcatacccagtctatgca
caacagaggcgatga

KEGG   Mus pahari (shrew mouse): 110336420
Entry
110336420         CDS       T05929                                 

Gene name
Pik3r2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04024  cAMP signaling pathway
mpah04062  Chemokine signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04070  Phosphatidylinositol signaling system
mpah04071  Sphingolipid signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04360  Axon guidance
mpah04370  VEGF signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04611  Platelet activation
mpah04613  Neutrophil extracellular trap formation
mpah04620  Toll-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04650  Natural killer cell mediated cytotoxicity
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04666  Fc gamma R-mediated phagocytosis
mpah04668  TNF signaling pathway
mpah04670  Leukocyte transendothelial migration
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04750  Inflammatory mediator regulation of TRP channels
mpah04810  Regulation of actin cytoskeleton
mpah04910  Insulin signaling pathway
mpah04914  Progesterone-mediated oocyte maturation
mpah04915  Estrogen signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04926  Relaxin signaling pathway
mpah04929  GnRH secretion
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah04973  Carbohydrate digestion and absorption
mpah05010  Alzheimer disease
mpah05017  Spinocerebellar ataxia
mpah05020  Prion disease
mpah05100  Bacterial invasion of epithelial cells
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05146  Amoebiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110336420 (Pik3r2)
   04014 Ras signaling pathway
    110336420 (Pik3r2)
   04015 Rap1 signaling pathway
    110336420 (Pik3r2)
   04370 VEGF signaling pathway
    110336420 (Pik3r2)
   04630 JAK-STAT signaling pathway
    110336420 (Pik3r2)
   04668 TNF signaling pathway
    110336420 (Pik3r2)
   04066 HIF-1 signaling pathway
    110336420 (Pik3r2)
   04068 FoxO signaling pathway
    110336420 (Pik3r2)
   04070 Phosphatidylinositol signaling system
    110336420 (Pik3r2)
   04072 Phospholipase D signaling pathway
    110336420 (Pik3r2)
   04071 Sphingolipid signaling pathway
    110336420 (Pik3r2)
   04024 cAMP signaling pathway
    110336420 (Pik3r2)
   04151 PI3K-Akt signaling pathway
    110336420 (Pik3r2)
   04152 AMPK signaling pathway
    110336420 (Pik3r2)
   04150 mTOR signaling pathway
    110336420 (Pik3r2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110336420 (Pik3r2)
  09143 Cell growth and death
   04210 Apoptosis
    110336420 (Pik3r2)
   04218 Cellular senescence
    110336420 (Pik3r2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110336420 (Pik3r2)
   04550 Signaling pathways regulating pluripotency of stem cells
    110336420 (Pik3r2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110336420 (Pik3r2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110336420 (Pik3r2)
   04613 Neutrophil extracellular trap formation
    110336420 (Pik3r2)
   04620 Toll-like receptor signaling pathway
    110336420 (Pik3r2)
   04625 C-type lectin receptor signaling pathway
    110336420 (Pik3r2)
   04650 Natural killer cell mediated cytotoxicity
    110336420 (Pik3r2)
   04660 T cell receptor signaling pathway
    110336420 (Pik3r2)
   04662 B cell receptor signaling pathway
    110336420 (Pik3r2)
   04664 Fc epsilon RI signaling pathway
    110336420 (Pik3r2)
   04666 Fc gamma R-mediated phagocytosis
    110336420 (Pik3r2)
   04670 Leukocyte transendothelial migration
    110336420 (Pik3r2)
   04062 Chemokine signaling pathway
    110336420 (Pik3r2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110336420 (Pik3r2)
   04923 Regulation of lipolysis in adipocytes
    110336420 (Pik3r2)
   04929 GnRH secretion
    110336420 (Pik3r2)
   04915 Estrogen signaling pathway
    110336420 (Pik3r2)
   04914 Progesterone-mediated oocyte maturation
    110336420 (Pik3r2)
   04917 Prolactin signaling pathway
    110336420 (Pik3r2)
   04926 Relaxin signaling pathway
    110336420 (Pik3r2)
   04935 Growth hormone synthesis, secretion and action
    110336420 (Pik3r2)
   04919 Thyroid hormone signaling pathway
    110336420 (Pik3r2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    110336420 (Pik3r2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110336420 (Pik3r2)
  09156 Nervous system
   04725 Cholinergic synapse
    110336420 (Pik3r2)
   04722 Neurotrophin signaling pathway
    110336420 (Pik3r2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110336420 (Pik3r2)
  09158 Development and regeneration
   04360 Axon guidance
    110336420 (Pik3r2)
   04380 Osteoclast differentiation
    110336420 (Pik3r2)
  09149 Aging
   04211 Longevity regulating pathway
    110336420 (Pik3r2)
   04213 Longevity regulating pathway - multiple species
    110336420 (Pik3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336420 (Pik3r2)
   05206 MicroRNAs in cancer
    110336420 (Pik3r2)
   05205 Proteoglycans in cancer
    110336420 (Pik3r2)
   05203 Viral carcinogenesis
    110336420 (Pik3r2)
   05230 Central carbon metabolism in cancer
    110336420 (Pik3r2)
   05231 Choline metabolism in cancer
    110336420 (Pik3r2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110336420 (Pik3r2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110336420 (Pik3r2)
   05212 Pancreatic cancer
    110336420 (Pik3r2)
   05225 Hepatocellular carcinoma
    110336420 (Pik3r2)
   05226 Gastric cancer
    110336420 (Pik3r2)
   05214 Glioma
    110336420 (Pik3r2)
   05221 Acute myeloid leukemia
    110336420 (Pik3r2)
   05220 Chronic myeloid leukemia
    110336420 (Pik3r2)
   05218 Melanoma
    110336420 (Pik3r2)
   05211 Renal cell carcinoma
    110336420 (Pik3r2)
   05215 Prostate cancer
    110336420 (Pik3r2)
   05213 Endometrial cancer
    110336420 (Pik3r2)
   05224 Breast cancer
    110336420 (Pik3r2)
   05222 Small cell lung cancer
    110336420 (Pik3r2)
   05223 Non-small cell lung cancer
    110336420 (Pik3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110336420 (Pik3r2)
   05017 Spinocerebellar ataxia
    110336420 (Pik3r2)
   05020 Prion disease
    110336420 (Pik3r2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110336420 (Pik3r2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110336420 (Pik3r2)
   04932 Non-alcoholic fatty liver disease
    110336420 (Pik3r2)
   04931 Insulin resistance
    110336420 (Pik3r2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110336420 (Pik3r2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110336420 (Pik3r2)
   05100 Bacterial invasion of epithelial cells
    110336420 (Pik3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336420 (Pik3r2)
   05170 Human immunodeficiency virus 1 infection
    110336420 (Pik3r2)
   05161 Hepatitis B
    110336420 (Pik3r2)
   05160 Hepatitis C
    110336420 (Pik3r2)
   05171 Coronavirus disease - COVID-19
    110336420 (Pik3r2)
   05164 Influenza A
    110336420 (Pik3r2)
   05162 Measles
    110336420 (Pik3r2)
   05168 Herpes simplex virus 1 infection
    110336420 (Pik3r2)
   05163 Human cytomegalovirus infection
    110336420 (Pik3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110336420 (Pik3r2)
   05169 Epstein-Barr virus infection
    110336420 (Pik3r2)
   05165 Human papillomavirus infection
    110336420 (Pik3r2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110336420 (Pik3r2)
   05142 Chagas disease
    110336420 (Pik3r2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110336420 (Pik3r2)
   01524 Platinum drug resistance
    110336420 (Pik3r2)
   01522 Endocrine resistance
    110336420 (Pik3r2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110336420 (Pik3r2)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    110336420 (Pik3r2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 Ribosomal_L22e Tai4 ATG11
Other DBs
NCBI-GeneID: 110336420
NCBI-ProteinID: XP_021074627
Ensembl: MGP_PahariEiJ_G0021631
LinkDB
Position
19
AA seq 722 aa
MAGAEGFQYRAVYPFRRERPEDLELLPGDLLVVSRVALQALGVADGGERCPHNVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPCPLGPRPLPARPLDGSSESGHILPDLAEQFSP
PDPAPPILVKLVEAIEQAEPDSECYSRLELPATRTDWSLSDLEQWDRTTLYDAVKGFLLA
LPAAVVTPEAAAEAYRALREVAGPVGQVLEPPTLPLHQALTLRFLLQHLGRVARRAPSPD
TAIHALASAFGPLLLRTPPAGGEGDGSEPVPDFPVLLLERLVQEHMEEQDAAPPALPPKP
SKAKPAPTALANGGNPPSLQDAEWYWGDISREEVNERLRDTPDGTFLVRDASSKIQGEYT
LTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVELISHYRHESLAQYNAKLDTRLLYPVS
KYQQDQVVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNE
TIKIFEEQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQDL
RAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVWLTQKGARQRKINEWLGIKNETEDQYS
LMEDEDALPHHEERTWYVGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTK
HCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPSA
AR
NT seq 2169 nt   +upstreamnt  +downstreamnt
atggcaggtgccgagggcttccaatacagggctgtgtacccgttccgccgggagcggccc
gaagacctggagctgctccctggggacctcctggtggtgagccgggtggccctgcaggca
cttggtgtggccgatggaggagagcgctgcccacacaatgtgggttggatgcctggcttc
aacgagcgcacccgacagcgaggggacttccccgggacatacgtggagttcctaggaccc
gtggctctggctcgaccaggcccttgcccactggggccccgtccgttgcccgccaggccc
ttggatggatcttctgagtcaggccacatactcccagacctggcagagcaattctcccca
cctgaccctgctcccccgattctggtgaagctggtagaagccattgagcaagcagagccg
gacagtgaatgctacagcaggctggagctgcccgcgacgcggacagactggtccctgagt
gacttggagcagtgggaccgcaccaccttgtatgatgctgttaagggcttcctgctggca
ttgcctgcagccgtggtgacccccgaagctgcagcagaggcataccgtgctctgcgagag
gttgcaggccctgtggggcaggtgctggaacccccgacactgccgctgcaccaggctctc
acgctgcgtttcctgctgcagcacctgggccgcgtggcccgcagagcgccctcgccagat
acagctatccatgcactggccagtgccttcgggccgctgctgctgcgcacacctccggca
gggggcgagggtgatgggagtgagcctgtacccgacttccctgtgctgctgctggagagg
ctggtgcaggagcacatggaggagcaagacgctgcccccccagcgctgccacctaagccc
tctaaggcaaagccggcacccacagctctcgccaacggagggaacccgccctcgcttcag
gatgcagagtggtactggggggacatctccagggaagaggtgaatgagaggctccgggac
acccctgatggtaccttcttagtcagagatgcgtccagcaagatccagggagagtacacg
ctcaccctcaggaaaggcgggaacaacaagctgatcaaagtcttccaccgggatggtcac
tacggcttctcagagccccttaccttctgctccgtggtggaactcatctcccactaccgc
cacgagtcactggcccagtacaacgccaagctggacacgcgccttctctaccctgtgtcc
aagtaccaacaagaccaggtggtgaaggaggacagtgtggaggctgtgggtgcccagctc
aaggtctaccaccagcagtaccaggacaagagccgcgaatacgaccagctgtatgaagaa
tacacacgcacctcccaggagcttcagatgaagcgcacagccatagaggccttcaacgag
accatcaagatcttcgaagagcagggccagacgcaggagaagtgcagcaaggagtacctg
gagcgcttccggcgggagggcaatgagaaggagatgcagaggatcctgctgaactctgag
cgactcaagtctcgcatcgcggagatacacgaaagccgcacgaagttggagcaggatctg
cgggcgcaggcctcagacaaccgtgagatcgacaagcgcatgaacagcctcaaacctgac
ctcatgcagctgcgcaagataagggaccagtacctcgtgtggctcacccagaaaggtgcc
cgacagaggaagatcaacgaatggctgggaatcaagaatgagactgaggaccagtattca
ctgatggaggatgaggacgccctcccccaccacgaggagcgcacgtggtacgtgggcaag
atcaaccgcacacaggcggaggagatgctgagtggcaaaagagatgggaccttcctcatc
cgggagagcagccagcggggctgttacgcatgctccgtggtggtggacggcgacacgaag
cactgtgtcatctaccgcacggccactggcttcggcttcgcagagccctataacctgtac
gggtccctgaaggagctggtgctgcactaccagcacgcatcgctcgtgcagcacaatgac
gcgcttaccgtcaccctcgcacaccctgtgcgtgcccccgggcctggcccaccgtctgca
gcacgctga

DBGET integrated database retrieval system