KEGG   Mus pahari (shrew mouse): 110319879
Entry
110319879         CDS       T05929                                 

Gene name
Pias3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110319879 (Pias3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110319879 (Pias3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110319879 (Pias3)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     110319879 (Pias3)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110319879 (Pias3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 110319879
NCBI-ProteinID: XP_021051204
Ensembl: MGP_PahariEiJ_G0026833
LinkDB
Position
4
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPVPLAPIPPTLLTPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLSVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQDGNQSESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGTLTSGHQPSSVLRSPAMGTLGSDFLSSLPLHDYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPG
SSLREGHGGPLPSGPSLTGCRSDVISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgagttaaagcacatggtgatgagtttccgagtgtctgagctccag
gtgctccttggcttcgctggcaggaacaagagtgggcggaaacacgagctgctggccaag
gccctgcacctcctcaagtctagctgcgcccccagcgtccagatgaagatcaaagaactt
taccgcaggcgctttccccggaagaccctggggccttctgatctctccttgctctctttg
ccccctggcacctctcctgtaggctcccctgtcccccttgctcccatcccccccaccctt
ctgacccccggcaccttgctaggccctaagcgtgaggtggacatgcaccctcctctgccg
cagcctgtgcaccccgatgtcaccatgaagccactgcccttctatgaagtctacggggaa
ctcatccgacccaccacccttgcatccacctccagccagaggttcgaggaagcccacttc
accttcgcgctcactccccagcagctgcagcagattctcacgtccagggaggtcctgcct
ggagccaagtgcgattacaccatacaagtgcagctcaggttctgtctctgtgagaccagc
tgccctcaggaggactatttcccccctaacctctttgttaaggttaatgggaaactctgc
cccctgccgggttacctccctccaaccaagaatggagctgagcccaagaggcccagccgt
ccgatcaacatcacacccctggctcgactctcagccactgttcccaacaccatcgtggtt
aactggtcatctgagtttggacggaattactccctgtccgtgtacctggtgaggcaattg
actgcagggacccttctacaaaaactcagagccaagggtatccggaatccagaccattcc
cgggcactgatcaaggagaaactgaccgctgaccccgacagtgaagtggctactacaagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgtctgtcccgtgtcgtgcc
ctcacctgtgcccacctgcagagtttcgatgctgccctttatctacagatgaatgaaaag
aagccgacatggacgtgtcctgtgtgtgataagaaggctccctatgagtcgctgattatt
gatggtttattcatggaaattcttaattcctgttcggattgtgatgagattcagttcatg
gaagacggatcctggtgtccaatgaaacccaagaaggaggcatcagaggtttgccccccg
ccagggtatgggctggatggtctccagtacagcccagtccaggatgggaatcagtcagag
agtaagaagagggttgaagtcattgacttgacaatcgaaagctcatcagatgaggaagat
ctgccccccaccaagaagcactgccctgttacctcggctgccattccagcccttcctgga
agcaaaggaaccctgacctctggtcaccagccatcctcggtgcttcggagccctgcaatg
ggcacactgggcagtgacttcctgtctagtctcccgctacatgactacccacctgccttc
ccactgggagctgacatccaaggtttagatttattttctttccttcagactgagagtcag
cactacggcccttcagttatcacttcgctagatgaacaggacacccttggccacttcttc
cagtaccggggaaccccttcccacttcctgggccctctggcccccacattggggagctct
caccgcagctccactccagcgccccctcctggtcgtgtcagcagcattgtggctcctggg
agttccttgagggaagggcatggaggacccctgccttcaggcccctctttgactggctgt
cggtcagatgtcatttctttggactga

KEGG   Mus pahari (shrew mouse): 110326368
Entry
110326368         CDS       T05929                                 

Gene name
Pias4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04064  NF-kappa B signaling pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04630  JAK-STAT signaling pathway
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110326368 (Pias4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110326368 (Pias4)
   04064 NF-kappa B signaling pathway
    110326368 (Pias4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110326368 (Pias4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110326368 (Pias4)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     110326368 (Pias4)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110326368 (Pias4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP YL1 Sporozoite_P67 DARPP-32 CENP-B_dimeris
Other DBs
NCBI-GeneID: 110326368
NCBI-ProteinID: XP_021060411
Ensembl: MGP_PahariEiJ_G0031034
LinkDB
Position
9
AA seq 507 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKSAEPGPQAPRPLDPLALHSMPRTPLSGPTVDYPVLYGKYLNGLGRLPTKTL
KPEVRLVKLPFFNMLDELLKPTELVPQSAEKLQESPCIFALTPRQVEMIRNSRELQPGVK
AVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTH
LMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSDLLQRLKTIGVKHPELCKALVKEKL
RLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKPTWMCPV
CDKPAAYDQLIIDGLLSKILSECEDADEIEFLAEGSWRPIRAEKEPSCSPQGPILVLGTS
DANGLTPASSTPGIGSGLGGPGGTGSSAGAAGSLENGKTGADVVDLTLDSSSSSEDEDED
EDDDEDEDEGPRPKRRCPFQKGLVPAC
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggcggcagagctggtggaggccaaaaacatggtgatgagcttccgagtatcagacctg
cagatgctgctgggctttgtaggccggagcaagagtgggctgaagcacgaactggtgacc
agggccttgcagctggtgcagttcgactgtagcccagagcttttcaagaagatcaaagag
ctgtatgagactcgctacgccaagaagagcgcagagcccggcccacaggcaccacggccc
ctggatcccctggcactacactccatgcccaggactcccctgtcagggcctaccgtggac
taccccgtgctgtacgggaagtacttgaatggactggggcgcctgcccaccaagaccctt
aagccggaggtacgcctggttaagctccccttcttcaacatgctggacgaattgctgaag
cccactgaactggtcccacagagcgcagagaagctgcaagagagcccgtgtatcttcgcg
ctaacacctcggcaggtggagatgatccgcaactccagggagctgcagcctggagtgaaa
gctgtgcaggtggtgctgaggatctgttactctgataccagctgtccacaggaggaccaa
tacccacccaacatcgctgtgaaggtcaaccacagctactgttcagtgccgggctactat
ccctccaacaagcctggtgtggaacctaagaggccctgccgccccatcaaccttacccac
ctcatgtatctgtcctcggccaccaaccgaattaccgtcacctggggcaactatggcaag
agctactccgtggctttgtacctggtgcgacagctgacctcctcagacctgctgcagagg
ttgaagacgattggggtgaagcaccctgagctgtgcaaggctctggtcaaggagaagctt
cgcctagaccctgacagcgagatcgccactactggagtacgagtgtcccttatctgccca
ctggtgaagatgcggctctcggtgccctgccgtgcagagacctgcgcacacctgcagtgc
tttgatgctgtgttctacctgcaaatgaacgagaagaagcccacctggatgtgccctgtg
tgtgacaagcctgcagcctatgaccagctcatcatagatgggctgctgtcaaagatcctg
agtgagtgtgaggacgcagatgagattgagttcttggcggaaggttcatggcgcccaatc
cgtgcagagaaggagccaagctgcagcccacagggccccatcctggtgctaggcacctca
gacgccaacgggctcacaccagcctccagcacccccggtataggcagtggcctgggcggc
ccaggcggcaccggcagcagtgcaggggcagcaggcagcctggagaacggcaagacagga
gctgacgtggtggacctcacactggacagctcatcgtcctcggaagatgaagatgaggac
gaggacgacgatgaggacgaggacgagggcccccggccgaagcgccgctgcccgttccag
aagggcctggtgcccgcttgctga

KEGG   Mus pahari (shrew mouse): 110327437
Entry
110327437         CDS       T05929                                 

Gene name
Pias1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04630  JAK-STAT signaling pathway
mpah05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110327437 (Pias1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110327437 (Pias1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110327437 (Pias1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110327437 (Pias1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mpah04812]
    110327437 (Pias1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     110327437 (Pias1)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110327437 (Pias1)
Cytoskeleton proteins [BR:mpah04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    110327437 (Pias1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse FAM53
Other DBs
NCBI-GeneID: 110327437
NCBI-ProteinID: XP_021062083
Ensembl: MGP_PahariEiJ_G0015195
LinkDB
Position
10
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPPTLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRTYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGSWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQAASHNQSSNKNKKVEVIDLTIDSSSDEEEEEPPAKRT
CPSLSPTSPLSNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSAS
LPATNGSSGGSNSSLVSSNSLRESHGHGVASRSSADTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggaggaacaagcacggacgcaaacacgaacttcttacaaaa
gccctgcatttgttaaaggctggctgtagtcctgctgtacaaatgaaaattaaagaactc
tacaggaggcggttccctcagaaaattatgacgcctgcggacttgtctatccccaacgta
cattcaagtcctatgcctccgactctttctccatccaccattccacagctcacttatgat
ggtcaccctgcatcatccccactactccctgtttctcttctgggacctaaacatgaactg
gaactcccacatctcacgtcagcgctgcacccagtccatccggacataaagctgcaaaaa
ctaccattctatgacctgttggacgaactgatcaaacccaccagtctagcttcagacaac
agccagcgctttcgggagacctgttttgcatttgccttgacaccacaacaggtgcagcag
atcagcagctccatggatatttctgggaccaaatgtgacttcacagtgcaggtccaatta
aggttttgtttatcagaaaccagttgtccacaagaagatcacttcccacccaacctttgt
gtaaaagtgaatacaaaaccttgcagccttccaggttaccttccacctactaaaaacggt
gtggaaccaaagcgacctagccgaccaattaatatcacctcacttgtccgattgtccacg
acagtaccaaataccattgttgtttcttggactgcagaaattggaagaacctattccatg
gcagtatatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttaactgcagatcca
gatagtgagatagctactaccagcctacgggtttcgctgctgtgtccacttgggaaaatg
cgactgacaatcccctgccgggcacttacctgctcccaccttcagtgttttgatgcaact
ctttacattcaaatgaatgagaaaaaaccaacatgggtttgtcctgtctgtgataagaag
gccccatatgaacaccttattattgacgggttgtttatggaaattctaaagtactgcaca
gactgtgacgagatacagtttaaggaggatggctcgtgggctccaatgaggtcaaagaag
gaggtgcaagaagtcagtgcctcctacaatggagtcgatggatgcctgagctccacattg
gagcatcaggcagcttcccacaaccagtcctcaaataaaaacaagaaagtggaggtcatt
gacctaaccattgacagctcgtcggatgaagaggaggaagaaccccctgccaagaggacc
tgtccttccctgtctcctacgtcaccactaagtaataaaggcattttaagtcttcctcat
caagcctcgcctgtgtcccgcaccccaagccttcctgctgtagatacaagctacatcaac
acctccctcatccaggactacaggcaccctttccacatgacgcccatgccttatgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccctg
cttgccgcagcggcagcggcggtctcagatgaccaggacctcctgcactcctcccggttt
ttcccgtatacctcctcgcagatgtttctcgatcagctaagtgcaggagggagcgcttct
ctgccagccaccaatggaagcagtggcggcagcaacagcagccttgtgtcttccaacagt
ctgagggagagccatggccatggcgtggccagcaggagcagcgcagacacagcgtccatc
tttggcatcataccagacattatctcattggactga

KEGG   Mus pahari (shrew mouse): 110332895
Entry
110332895         CDS       T05929                                 

Gene name
Pias2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04120  Ubiquitin mediated proteolysis
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110332895 (Pias2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110332895 (Pias2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpah04121]
    110332895 (Pias2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     110332895 (Pias2)
Ubiquitin system [BR:mpah04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110332895 (Pias2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 110332895
NCBI-ProteinID: XP_021069899
Ensembl: MGP_PahariEiJ_G0019144
LinkDB
Position
15
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSITPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVTSQPCTKVESSSVFSKPCSVTVASDASKKKIDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
VSSMSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSPHESSTHVSSSS
SRSDTGVITSSGSHIPDVISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaggagttgaggaatatggtttctagttttagggtttctgaattacaa
gtgttactgggctttgctggacggaataaaagtgggcgcaagcatgacctcctgatgagg
gcgttgcatttattgaagagtggctgcagccctgcggttcagattaaaattcgagaatta
tatagacgccgatacccacggacacttgaaggactttctgacctatccacaatcaaatca
tcggttttcagtttggatggtagttcatcaccagtagaacctgacttggctgtggctgga
atccactcgttgccttctacttcaattacacctcattcaccatcatctcctgttggttct
gtgctgctgcaagacactaagcccacctttgagatgcagcagccatctcctcccattcct
cctgtccatcctgatgtgcagttaaaaaacctgcccttttatgatgtccttgatgttctc
atcaagcccacaagtttagttcaaagcagtattcagcggtttcaagagaagttttttatt
tttgctttgacacctcagcaagttagagagatatgtatttcaagggattttttgccgggt
ggcaggagagactatacagtccaagtccagctgcgactttgcttggcagagaccagttgc
cctcaagaagataactatcccaatagtttgtgtataaaagtcaatgggaaactctttcct
ttgcctggctatgcgccaccacctaaaaatgggattgaacagaagcgccctggacgcccc
ctgaacataacatctttagttaggttgtcttcagctgtgccaaatcagatttctatttct
tgggcatctgaaattggaaagaattactccatgtctgtgtatcttgtacgacagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaatcctgatcattccaga
gcactaattaaagaaaaacttactgcagaccctgatagtgaaattgctacaactagtctt
cgagtgtccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctgcagtgctttgatgctgccctttatcttcagatgaatgagaaaaag
cccacctggatctgtcctgtttgtgataaaaaggctgcctatgagagtctaatactggat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaggaa
gatggttcttggtgtcctatgagacctaaaaaagaagctatgaaagtaaccagccagccc
tgtacaaaagtagaaagttcaagtgtctttagtaaaccttgttcagtgactgtagccagt
gatgcaagcaagaagaagatagatgttattgatctaacaatagagagctcttctgatgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagtcca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcagtt
gatcctgctgctattccaccttcattaacagactactcagtaccattccaccacacgcca
gtgtcaagcatgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagc
agtacgtctgtcaccaccaccagcccccatgaaagcagtactcacgttagttcatccagc
agcaggagtgacacaggggttataaccagcagtgggagtcacattcctgacgtcatctct
ttggactaa

DBGET integrated database retrieval system