KEGG   Mus pahari (shrew mouse): 110320006
Entry
110320006         CDS       T05929                                 

Gene name
Egf
Definition
(RefSeq) pro-epidermal growth factor isoform X1
  KO
K04357  epidermal growth factor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04014  Ras signaling pathway
mpah04015  Rap1 signaling pathway
mpah04020  Calcium signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04068  FoxO signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04510  Focal adhesion
mpah04540  Gap junction
mpah04630  JAK-STAT signaling pathway
mpah04810  Regulation of actin cytoskeleton
mpah05160  Hepatitis C
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05226  Gastric cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110320006 (Egf)
   04012 ErbB signaling pathway
    110320006 (Egf)
   04014 Ras signaling pathway
    110320006 (Egf)
   04015 Rap1 signaling pathway
    110320006 (Egf)
   04630 JAK-STAT signaling pathway
    110320006 (Egf)
   04066 HIF-1 signaling pathway
    110320006 (Egf)
   04068 FoxO signaling pathway
    110320006 (Egf)
   04020 Calcium signaling pathway
    110320006 (Egf)
   04072 Phospholipase D signaling pathway
    110320006 (Egf)
   04151 PI3K-Akt signaling pathway
    110320006 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110320006 (Egf)
   04540 Gap junction
    110320006 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110320006 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320006 (Egf)
   05231 Choline metabolism in cancer
    110320006 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110320006 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110320006 (Egf)
   05212 Pancreatic cancer
    110320006 (Egf)
   05226 Gastric cancer
    110320006 (Egf)
   05214 Glioma
    110320006 (Egf)
   05218 Melanoma
    110320006 (Egf)
   05219 Bladder cancer
    110320006 (Egf)
   05215 Prostate cancer
    110320006 (Egf)
   05213 Endometrial cancer
    110320006 (Egf)
   05224 Breast cancer
    110320006 (Egf)
   05223 Non-small cell lung cancer
    110320006 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110320006 (Egf)
   05165 Human papillomavirus infection
    110320006 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320006 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110320006 (Egf)
Cytokines and growth factors [BR:mpah04052]
 Growth factors
  Growth factors (RTK binding)
   110320006 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 SGL Plasmod_Pvs28 EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 110320006
NCBI-ProteinID: XP_021051480
Ensembl: MGP_PahariEiJ_G0027073
LinkDB
Position
4
AA seq 1222 aa
MPWGRRPTCLLLAFLLLFLKISVFSVTAWQTGNCQPGPLERSERSGTSICAGPAPFLVFS
QGKSISRIDPDGTNHQQLVVDAGVSAVMDFHYKEERLYWVDLERQLLQRVFFNGSRQEKV
CNVEKTVSGLAINWIDDEILWADQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERL
MFWSSEVTGSLHRAHLSGVDVKILLETPGGVSVLTLDVLDKLLFWVQDSGEGSHAYIHSC
DYNGGSVRLIRHQARHSLFSMAFSGDRIFYSALKEKSIWIANKHTGKDTVRMNLHPSFVA
PGELKVVHTLAQPRTEDGAQGPDSEGCKQKRGPCRYSLCERDPKSQSCACAEGYTLSRDR
KYCEDVNECAFQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKRCHELVSCPGNVSKCSHD
CVLTSDGPRCICPSGSVLRRDGKTCSGCSSPDNGGCSQICLPLRPGSWECGCFPGYDLQS
DGKSCAASGPQPLLLFANSQDIRHMHFDGTDYRTLLSRQMGMVFAVDYDPVESKIYFAQT
ALKWIERANMDGSQRERLITEGVDTPEGLAVDWIGRRIYWTDSGKSVVGGSDLNGKHHQV
IIKENISRPRGIAVHPKARRLFWTDTGMSPRIESASLQGSGRVLIASSNLLEPSGITIDF
LTDTLYWCDTKRSVIEMANLDGSKRRRLTQSDIGHPFALAVFEDHVWFSDWAIPSVIRVN
KRTGQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLHRNGGCQHICQESLGTAQCFCREGF
VKAQDGKMCLARKDHPILAGDNADLSKEVTSLNNSTKAEVPDNGGTESSTLVAEIMVSGM
NYEDDCGPGGCGSHAHCVSDGEAAECQCLKGFVRDGNVCSDIDECALARPDCPTPSSRCI
NTEGGYVCRCSEGYEGDGISCVDIDECQQGAHKCGKNAACTNTEGGYNCTCAGRPSAPGR
TCPDSTPPPLLGEDGHHLDRNSYPECPPSYDGYCFNGGVCIHIESLNTYACNCVVGYSGD
RCQTQNLKWWELRHAGYGQKQDITVVAVCVVALVLLLLLGMWGTYYYRTQKQLSKPPKNP
CDEPSGSVSGSGHGGSSSGAGVASCPQPWFVVLEEHQEPKNGSLPAAGTNGAVVDAGLSP
SLRLGSVHLTSWRQKPHMDGMGTGQSCCIPPSSDKGPQEMEGNSHLPCYSPMGPEKLHSL
HSANGSCHQRAPDLPRQTEPVQ
NT seq 3669 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctgtctgttgctcgccttcctgctgctgtttttaaag
attagtgtattcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttccatttgtgctggtcctgcccccttcctagttttctca
caaggaaagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtg
gatgctggcgtctcagcggtcatggattttcattataaagaagagagactctattgggtg
gatttagaaagacaacttttgcaaagagttttctttaatgggtcaagacaagagaaagtg
tgcaatgtagagaagacggtgtctgggctggccataaactggatagatgatgagattctc
tgggcagaccaacagaacggagtcatcactgtaacagatatgacagggaaaaattcccga
gttcttctaagttccttaaaacatccatcaaatatagcagtggatccaatagagaggttg
atgttttggtcttcagaggtgaccggcagccttcacagagcacatcttagtggtgtggat
gtaaaaatactgctggagacaccagggggggtatcggtgctgactctggatgtcctggac
aaactgctcttctgggttcaggacagtggcgaaggaagccatgcttacattcattcctgt
gattacaacggtggctccgtccgtcttatcagacatcaagcacggcacagtttgttttca
atggccttttctggtgatcggatcttttactcagcgttgaaagagaagtcgatttggata
gccaacaaacacactgggaaggacacggttaggatgaacctccatccatcctttgtggct
cctggagaactgaaggtagtacacacgcttgcacagccccggacagaggacggtgctcag
ggccctgactccgaaggttgcaaacagaagagaggaccatgccgctacagtctctgtgag
cgagaccctaagtcccagtcgtgcgcatgcgccgagggctacacgttaagccgagaccgg
aagtactgcgaagatgtcaatgagtgtgcctttcagaatcacggctgtactcttgggtgt
gaaaacacccctggatcctatcactgcacgtgccccacaggatttgttctgcttcctgat
gggaaacggtgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagccatgac
tgtgtcctgacatcagatggtccccggtgcatctgtccctcaggttcagtgctcaggaga
gatgggaagacatgctctggttgttcatcgcctgacaatggtggatgcagccagatctgt
cttcctctcaggccaggatcctgggaatgtggttgctttcctgggtatgacctacaatca
gacggaaagagctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccag
gacatccgacacatgcattttgatggaacagactatagaactctgctcagccggcagatg
ggaatggtttttgctgtagattatgaccctgtggaaagcaagatatattttgcacagaca
gccctgaagtggatagagagggctaatatggatgggtcccagcgagaaagactgatcaca
gaaggagtagacacgcctgaaggtcttgccgtggactggattggccggagaatctactgg
acagacagtgggaagtctgttgttggagggagtgatttgaatgggaaacatcatcaagta
atcatcaaagagaacatctcgaggccccgaggaatagctgtgcatccgaaggccaggaga
ctattctggacggacacggggatgtctccgcggattgaaagtgcttcccttcaaggttcc
ggccgggtgctaatagccagctctaatctactggaacccagtgggatcacgattgacttc
ttaacagacactttgtactggtgtgacaccaagcggtctgtcattgaaatggccaatctg
gatggctccaaacgccgaagacttacccagagcgatataggtcacccctttgctctagcc
gtgtttgaggatcacgtgtggttctcggattgggctatcccctcggtaataagggtgaac
aagaggactggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactg
gttgtggtccatccattggcaaaaccaggtgcagatccctgcttacacaggaatggaggc
tgccaacacatctgccaagagagcctgggcacagctcagtgtttttgtcgggaaggtttt
gtgaaagcccaggatgggaaaatgtgtctcgctcggaaggatcatccgatactggcaggt
gacaatgctgatcttagtaaagaggtgacatcattgaacaactccactaaggctgaagta
ccagacaatggcgggacagaatcttccacactagtggctgaaatcatggtgtcaggaatg
aactatgaagatgactgcggccctggggggtgtggcagccacgctcactgcgtttcagac
ggagaggctgctgagtgtcagtgtctgaaaggatttgtcagggatggaaacgtgtgttct
gatatagatgagtgtgcgctggccagaccagactgtcccaccccctcgtccaggtgcatc
aacactgaagggggctacgtctgcagatgctcagaaggctatgaaggagacgggatctcc
tgtgtcgatattgacgagtgccagcagggggcgcacaagtgcggtaagaatgccgcctgt
accaacacggagggaggctacaactgcacctgcgcaggccgcccatcagcacctggacgg
acttgccctgactctaccccaccccctctccttggggaagatggccaccatttggaccga
aatagttacccagaatgcccaccgtcatatgatggatactgcttcaatggtggcgtgtgt
atacatattgaatcactgaatacctacgcatgcaactgcgttgttggctattctggggat
cgatgtcagactcaaaacttaaaatggtgggagctgcgtcatgctggctacgggcagaag
caggacatcacagtggtggccgtctgcgtggtggcgctggtcctgctgctcctcttgggg
atgtgggggacttactactacaggactcagaagcagctatcaaaacccccaaagaaccct
tgtgatgagccaagcggaagtgtgagcggcagcgggcacggcggcagcagcagcggggct
ggtgtggcttcttgtccccaaccttggtttgtggtcctagaggaacaccaagagcccaag
aatgggagtctgcctgcggctggtacgaacggtgcagtagtagatgctggtctgtctccc
tccctgcggctcgggtcagtgcatctgacttcatggagacagaagccccacatggatgga
atgggcacaggacaaagctgctgcattccaccgtcaagtgacaaaggaccccaggaaatg
gagggaaactcccacctcccctgctacagccccatggggccagagaagctgcattccctc
cattcagctaatggatcatgtcaccaaagggctccggacctgccacggcagacagagcca
gttcagtag

DBGET integrated database retrieval system