KEGG   Mus pahari (shrew mouse): 110320030
Entry
110320030         CDS       T05929                                 

Gene name
Bax
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04071  Sphingolipid signaling pathway
mpah04115  p53 signaling pathway
mpah04141  Protein processing in endoplasmic reticulum
mpah04210  Apoptosis
mpah04211  Longevity regulating pathway
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04722  Neurotrophin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05012  Parkinson disease
mpah05014  Amyotrophic lateral sclerosis
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110320030 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    110320030 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110320030 (Bax)
   04215 Apoptosis - multiple species
    110320030 (Bax)
   04217 Necroptosis
    110320030 (Bax)
   04115 p53 signaling pathway
    110320030 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110320030 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    110320030 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320030 (Bax)
   05202 Transcriptional misregulation in cancer
    110320030 (Bax)
   05203 Viral carcinogenesis
    110320030 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110320030 (Bax)
   05212 Pancreatic cancer
    110320030 (Bax)
   05225 Hepatocellular carcinoma
    110320030 (Bax)
   05226 Gastric cancer
    110320030 (Bax)
   05214 Glioma
    110320030 (Bax)
   05216 Thyroid cancer
    110320030 (Bax)
   05220 Chronic myeloid leukemia
    110320030 (Bax)
   05217 Basal cell carcinoma
    110320030 (Bax)
   05218 Melanoma
    110320030 (Bax)
   05213 Endometrial cancer
    110320030 (Bax)
   05224 Breast cancer
    110320030 (Bax)
   05222 Small cell lung cancer
    110320030 (Bax)
   05223 Non-small cell lung cancer
    110320030 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    110320030 (Bax)
   05014 Amyotrophic lateral sclerosis
    110320030 (Bax)
   05016 Huntington disease
    110320030 (Bax)
   05020 Prion disease
    110320030 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    110320030 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110320030 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110320030 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110320030 (Bax)
   05152 Tuberculosis
    110320030 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320030 (Bax)
   05170 Human immunodeficiency virus 1 infection
    110320030 (Bax)
   05161 Hepatitis B
    110320030 (Bax)
   05160 Hepatitis C
    110320030 (Bax)
   05164 Influenza A
    110320030 (Bax)
   05162 Measles
    110320030 (Bax)
   05168 Herpes simplex virus 1 infection
    110320030 (Bax)
   05163 Human cytomegalovirus infection
    110320030 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110320030 (Bax)
   05169 Epstein-Barr virus infection
    110320030 (Bax)
   05165 Human papillomavirus infection
    110320030 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110320030 (Bax)
   01524 Platinum drug resistance
    110320030 (Bax)
   01522 Endocrine resistance
    110320030 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110320030 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpah02000]
    110320030 (Bax)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110320030 (Bax)
Transporters [BR:mpah02000]
 Other transporters
  Pores ion channels [TC:1]
   110320030 (Bax)
SSDB
Motif
Pfam: Bcl-2 CF222 Bclx_interact
Other DBs
NCBI-GeneID: 110320030
NCBI-ProteinID: XP_021051539
Ensembl: MGP_PahariEiJ_G0012946
LinkDB
Position
1
AA seq 192 aa
MDGSGEQLGSGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGDTPELTLEQPPQDASTKKLS
ECLRRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggggagcagctcgggagcggcgggcccaccagctctgaacagatcatg
aagacaggagcctttttgctacagggtttcatccaggatcgagcagggaggatggctggg
gacacacctgagctgaccttggagcagccgccccaggatgcgtccaccaagaagctgagc
gagtgtctccggcgaattggagatgaactggacagcaatatggagctgcagaggatgatt
gctgacgtggatacggactccccccgagaggtcttctttcgtgtggcagctgacatgttt
gctgatggcaacttcaactggggccgggtggttgcccttttctactttgctagcaaactg
gtgctcaaggccctgtgcactaaagtgcccgagctgatcagaaccatcatgggctggaca
ctggacttcctccgtgagcggctgcttgtctggatccaagaccagggtggctgggatggc
ctcctctcctacttcgggaccccaacatggcagacagtgaccatctttgtggctggagtc
ctcaccgcctcgctcaccatctggaagaagatgggctga

DBGET integrated database retrieval system