KEGG   Mus pahari (shrew mouse): 110320068
Entry
110320068         CDS       T05929                                 

Gene name
Ccna2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04152  AMPK signaling pathway
mpah04218  Cellular senescence
mpah04914  Progesterone-mediated oocyte maturation
mpah05161  Hepatitis B
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110320068 (Ccna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110320068 (Ccna2)
   04218 Cellular senescence
    110320068 (Ccna2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110320068 (Ccna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320068 (Ccna2)
   05202 Transcriptional misregulation in cancer
    110320068 (Ccna2)
   05203 Viral carcinogenesis
    110320068 (Ccna2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110320068 (Ccna2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320068 (Ccna2)
   05161 Hepatitis B
    110320068 (Ccna2)
   05169 Epstein-Barr virus infection
    110320068 (Ccna2)
   05165 Human papillomavirus infection
    110320068 (Ccna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpah03032]
    110320068 (Ccna2)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110320068 (Ccna2)
DNA replication proteins [BR:mpah03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110320068 (Ccna2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110320068 (Ccna2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 110320068
NCBI-ProteinID: XP_021051611
Ensembl: MGP_PahariEiJ_G0026380
LinkDB
Position
4
AA seq 423 aa
MPGTSRQSGRDAGSALLSLHQEDQENVNPEKLAPAQQPRAQAVLKDGNVRGPAPQQRLKT
RRVAPLKDLPINDEHVTAAPSWKAVSKQPAFTIHVDKAEETQKRPAELKETECDDALAFN
AAVSLPGARKPLTPLDYPMDGSFESPHAMDMSIVLEDEKPVNVNEVPDYQDDVHTYLREM
EVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVL
RGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAP
TVNQFLTQYFLHLQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTG
QSWPESLVQQTGYTLESLKPCLVDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
LNV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgccgggcacctcgagacagtcgggtcgcgatgcgggctcagccctgctctcgctgcat
caggaagaccaagagaatgtcaaccccgaaaaactggcgccagcccagcagccgcgggcg
caggcggtgctgaaggacgggaacgtgcggggacccgcgccgcagcagaggctcaagact
cgacgggttgcacctcttaaggaccttcctataaacgatgagcatgtcaccgctgcccct
tcatggaaagcagtcagtaaacagcctgccttcaccattcatgtggacaaagcagaagag
actcagaagaggccagctgagcttaaagaaaccgagtgtgacgatgccctggcttttaat
gcagctgtctctttacctggagcaagaaaaccactgacacctcttgactatccaatggat
ggtagttttgaatcaccacatgctatggatatgtctattgtcttagaagacgaaaagcca
gtgaatgttaatgaagtacctgactatcaagatgatgttcacacgtaccttagggaaatg
gaggttaaatgtaaacctaaagtgggttacatgaagaggcagccggatatcactaacagc
atgcgggctatccttgtggactggctggttgaagtgggagaagaatataaactacagaat
gagaccctgcatttggctgtgaactacattgatagattcctctcctccatgtctgtgtta
agagggaagctgcagcttgtgggcactgctgctatgctgctagcttcgaagtttgaagaa
atataccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaag
caggttctgagaatggagcacctagtattgaaagtccttgcttttgacttggctgcacca
acagtaaatcagttccttacccagtacttcctgcacctgcagcctgcaaactgtaaggtt
gaaagcttagcaatgtttttgggagaattgagtttgatagatgctgacccatacctcaag
tatttgccttcagttattgctggagctgcctttcacttagcgctctacacagtcacagga
caaagctggcctgagtcattggtacaacagactggatataccctggaaagtcttaagcct
tgccttgtggaccttcaccagacctacctcaaagccccacagcatgcccaacagtcaata
cgggaaaagtacaagcattcaaaatatcacagtgtttctcttctcaacccaccagagaca
ctaaatgtgtga

KEGG   Mus pahari (shrew mouse): 110320587
Entry
110320587         CDS       T05929                                 

Gene name
Ccna1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04110  Cell cycle
mpah04152  AMPK signaling pathway
mpah04218  Cellular senescence
mpah04914  Progesterone-mediated oocyte maturation
mpah05161  Hepatitis B
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110320587 (Ccna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110320587 (Ccna1)
   04218 Cellular senescence
    110320587 (Ccna1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    110320587 (Ccna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320587 (Ccna1)
   05202 Transcriptional misregulation in cancer
    110320587 (Ccna1)
   05203 Viral carcinogenesis
    110320587 (Ccna1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110320587 (Ccna1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320587 (Ccna1)
   05161 Hepatitis B
    110320587 (Ccna1)
   05169 Epstein-Barr virus infection
    110320587 (Ccna1)
   05165 Human papillomavirus infection
    110320587 (Ccna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpah03032]
    110320587 (Ccna1)
   03036 Chromosome and associated proteins [BR:mpah03036]
    110320587 (Ccna1)
DNA replication proteins [BR:mpah03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    110320587 (Ccna1)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    110320587 (Ccna1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Peroxidase_2 Cyclin_N2
Other DBs
NCBI-GeneID: 110320587
NCBI-ProteinID: XP_021052329
Ensembl: MGP_PahariEiJ_G0026438
LinkDB
Position
4
AA seq 421 aa
MHRQSSKSGVALPPVGQGPDACQMLTRAQLGQDPQQRTVLGVLTENEQYRRTCGQEITAI
RCFSGSENVFPAAGKKVLPDHGVSEPAKRGFDIYMDDPEQGNRDSCPGREGIVFEDVYEV
DTSMLKSDLHFLLDFNTVSPMLVDPTTHAQSEEATDFGSDVINVTEYAEEIHCYLREAEV
RHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYMVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQQAIREKYKASKYLHVSLMEPPVILPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcatcgccagagctccaagagtggagtcgctctgcctccagtgggccaaggtcctgat
gcttgtcaaatgctcacccgagctcagcttggccaggatccccaacagagaacggtgcta
ggggtgttgactgaaaatgagcagtacaggaggacctgtggccaggagatcacagcaatc
agatgtttttctggatcagaaaatgtcttccctgcggctggaaagaaagtgctccctgac
catggagtcagtgagccagccaagcgtggatttgatatctacatggatgaccctgaacag
gggaacagagacagctgcccggggagagagggcatcgtatttgaggatgtgtatgaagtc
gacaccagcatgctcaagtcagatctccacttcctgctggatttcaacacagtttcccca
atgctggttgaccccaccacccatgcccagtcagaggaagcaacggattttggttcagat
gtgattaacgtaacggaatacgcagaggagattcattgctaccttcgagaagctgaagta
agacacagacccaaggctcactacatgaggaagcagccggacatcacggagggcatgcgc
gccatcctggtggactggctggtggaggttggggaagaatataaacttcgcacagagacc
ctgtacttggctgtcaacttcctggacaggtttctctcctgcatgtctgttctgagaggg
aaattgcagcttgtcgggacagcagctattctcctggcttcgaaatacgaagagatatat
ccgcccgacgtggatgagtttgtttacatcactgacgatacgtacacgaagcgacagctg
ctaaggatggagcatctgctactcaaagttctggcatttgatctgacggttccaaccacc
aaccagttcctccttcaatacctaaggcgacaaggagtgtgcatcagaactgagaatttg
gccaagtatgttgcagaactgagccttctggaagctgacccattcttgaagtatctccct
tccttggttgctgcagcagcttactgcctggcaaattatatggtgaacagacacttctgg
ccagaaacgcttgctgcatttacaggctattcattaaatgagattgtgccttgcctgagt
gagctacataaagcctgcctcagtatcccccatcgaccacagcaagcaatcagggagaag
tacaaggcttcgaagtacctgcacgtgtccctcatggaaccacctgtaattcttcccctg
cagtga

DBGET integrated database retrieval system