KEGG   Mus pahari (shrew mouse): 110320091
Entry
110320091         CDS       T05929                                 

Gene name
Wwtr1
Definition
(RefSeq) WW domain-containing transcription regulator protein 1 isoform X1
  KO
K16820  WW domain-containing transcription regulator protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110320091 (Wwtr1)
   04392 Hippo signaling pathway - multiple species
    110320091 (Wwtr1)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 110320091
NCBI-ProteinID: XP_021051649
Ensembl: MGP_PahariEiJ_G0026449
LinkDB
Position
4
AA seq 452 aa
MHNSTAPLSARLFLRGGSLLQTLFMGQSGSRGGCSRLRLLCRLLSPCERPRPAPGMKMNP
SSVPHPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSR
QSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGGPAQQHAHLRQQSYDVTDE
LPLPPGWEMTFTAAGQRYFLNHIEKITTWQDPRKVMNQPLNHVNLHPSITSTSVPQRSMA
VSQPNLAMNHQHQQVVATSLSPQNHPTQNPPTGLMSVPNALTTQQQQQQKLRLQRIQMER
ERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMSTDMRSVTNSSSDPFLNGGPYHSR
EQSTDSGLGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQTRFPDFLDCLPGTN
VDLGTLESEDLMPLFNDVESALNKSEPFLTWL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcataattcaacagctccactttcggcccgcctctttcttaggggtgggagtttgctg
caaactttgtttatgggacagtccgggagccgcggcggctgctctcgtctacgtcttctc
tgtcgcctcctctcgccgtgcgagcgcccgaggccggctccggggatgaagatgaatccg
tcctcggtgccccatccgctcccgccgccagggcagcaagtcatccacgtcacgcaggac
ctggacacggacctcgaagccctcttcaactctgtcatgaaccccaagcccagctcatgg
cggaaaaagatcctcccggagtccttctttaaggagccggattccggctcgcactcgcgc
cagtccagcaccgactcatcgggcggccacccggggcctcgactagctggcggcgcgcag
cacgtccgctcgcactcgtcgcccgcatccctgcagctaggcaccggtgcgggagccgct
ggaggccctgcacagcagcatgcacatctccgccagcagtcctatgacgtgaccgacgag
ctgccgttgccccccgggtgggagatgaccttcacggccgctggccagagatacttcctt
aatcacatagagaaaatcaccacatggcaagaccccaggaaggtgatgaatcagcctctg
aatcatgtgaacctccacccctctatcacttccacatcggtgccacagaggtccatggca
gtgtcccagccgaatctcgcgatgaatcaccagcaccagcaagtcgtggccactagcctg
agtccacagaaccacccgactcagaacccacccacggggctcatgagtgtgcccaatgca
ctgaccactcagcagcagcagcagcagaaactgcgccttcagaggatccagatggagaga
gagaggattaggatgcgtcaagaggagctcatgaggcaggaagctgccctctgccgacag
ctccccatggaaaccgagaccatggctcctgtcaacacgcctgccatgagcacagatatg
agatctgttaccaacagtagctcagatcctttcctcaatggagggccctatcattcgcgg
gagcagagcacagacagcggcctggggttagggtgctacagtgtccccacaactccagaa
gacttcctcagcaacatggatgagatggatacaggtgaaaattccggtcagacacccatg
accgtcaatccccagcagacccgcttccctgatttcctggactgccttccgggaacaaac
gttgacctcgggactctggagtccgaagatctgatgccccttttcaatgatgtagagtct
gctctgaacaaaagcgagccctttctaacctggctgtaa

DBGET integrated database retrieval system