KEGG   Mus pahari (shrew mouse): 110320091
Entry
110320091         CDS       T05929                                 

Gene name
Wwtr1
Definition
(RefSeq) WW domain-containing transcription regulator protein 1 isoform X1
  KO
K16820  WW domain-containing transcription regulator protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110320091 (Wwtr1)
   04392 Hippo signaling pathway - multiple species
    110320091 (Wwtr1)
SSDB
Motif
Pfam: WW
Other DBs
NCBI-GeneID: 110320091
NCBI-ProteinID: XP_021051649
Ensembl: MGP_PahariEiJ_G0026449
LinkDB
Position
4
AA seq 452 aa
MHNSTAPLSARLFLRGGSLLQTLFMGQSGSRGGCSRLRLLCRLLSPCERPRPAPGMKMNP
SSVPHPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSR
QSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGGPAQQHAHLRQQSYDVTDE
LPLPPGWEMTFTAAGQRYFLNHIEKITTWQDPRKVMNQPLNHVNLHPSITSTSVPQRSMA
VSQPNLAMNHQHQQVVATSLSPQNHPTQNPPTGLMSVPNALTTQQQQQQKLRLQRIQMER
ERIRMRQEELMRQEAALCRQLPMETETMAPVNTPAMSTDMRSVTNSSSDPFLNGGPYHSR
EQSTDSGLGLGCYSVPTTPEDFLSNMDEMDTGENSGQTPMTVNPQQTRFPDFLDCLPGTN
VDLGTLESEDLMPLFNDVESALNKSEPFLTWL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcataattcaacagctccactttcggcccgcctctttcttaggggtgggagtttgctg
caaactttgtttatgggacagtccgggagccgcggcggctgctctcgtctacgtcttctc
tgtcgcctcctctcgccgtgcgagcgcccgaggccggctccggggatgaagatgaatccg
tcctcggtgccccatccgctcccgccgccagggcagcaagtcatccacgtcacgcaggac
ctggacacggacctcgaagccctcttcaactctgtcatgaaccccaagcccagctcatgg
cggaaaaagatcctcccggagtccttctttaaggagccggattccggctcgcactcgcgc
cagtccagcaccgactcatcgggcggccacccggggcctcgactagctggcggcgcgcag
cacgtccgctcgcactcgtcgcccgcatccctgcagctaggcaccggtgcgggagccgct
ggaggccctgcacagcagcatgcacatctccgccagcagtcctatgacgtgaccgacgag
ctgccgttgccccccgggtgggagatgaccttcacggccgctggccagagatacttcctt
aatcacatagagaaaatcaccacatggcaagaccccaggaaggtgatgaatcagcctctg
aatcatgtgaacctccacccctctatcacttccacatcggtgccacagaggtccatggca
gtgtcccagccgaatctcgcgatgaatcaccagcaccagcaagtcgtggccactagcctg
agtccacagaaccacccgactcagaacccacccacggggctcatgagtgtgcccaatgca
ctgaccactcagcagcagcagcagcagaaactgcgccttcagaggatccagatggagaga
gagaggattaggatgcgtcaagaggagctcatgaggcaggaagctgccctctgccgacag
ctccccatggaaaccgagaccatggctcctgtcaacacgcctgccatgagcacagatatg
agatctgttaccaacagtagctcagatcctttcctcaatggagggccctatcattcgcgg
gagcagagcacagacagcggcctggggttagggtgctacagtgtccccacaactccagaa
gacttcctcagcaacatggatgagatggatacaggtgaaaattccggtcagacacccatg
accgtcaatccccagcagacccgcttccctgatttcctggactgccttccgggaacaaac
gttgacctcgggactctggagtccgaagatctgatgccccttttcaatgatgtagagtct
gctctgaacaaaagcgagccctttctaacctggctgtaa

KEGG   Mus pahari (shrew mouse): 110327706
Entry
110327706         CDS       T05929                                 

Gene name
Yap1
Definition
(RefSeq) transcriptional coactivator YAP1 isoform X1
  KO
K16687  transcriptional coactivator YAP1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110327706 (Yap1)
   04392 Hippo signaling pathway - multiple species
    110327706 (Yap1)
SSDB
Motif
Pfam: WW FAM181 DUF3652
Other DBs
NCBI-GeneID: 110327706
NCBI-ProteinID: XP_021062508
Ensembl: MGP_PahariEiJ_G0014641
LinkDB
Position
10
AA seq 488 aa
MEPAQQPPPQPAPQGPAPPSVSPAGTPAAPPAPPAGHQVVHVRGDSETDLEALFNAVMNP
KTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLG
AVSPGTLTASGVVSGPAATPAAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHNDQ
TTTWQDPRKAMLSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKT
TSWLDPRLDPRFAMNQRITQSAPVKQPPPLAPQSPQGGVLGGGSSNQQQQIQLQQLQMEK
ERLRLKQQELFRQAIRNINPSTANAPKCQELALRSQLPALEQDGGTQNAVSSPGMSQELR
TMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSIPRTPDDFLNSVDEMDTGDTISQSTLP
SQQSRFPDYLEALPGTNVDLGTLEGDAMNIEGEELMPSLQEALSSEILDVESVLAATKLD
KESFLTWL
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggagcccgcgcaacagccgccgccccagccggccccgcaaggccccgcgccgccgtcc
gtgtctccggccgggacccccgcggccccgcccgcacccccggccggccaccaggtcgtg
cacgtccgcggggactcggagaccgacttggaggcgctcttcaatgccgtcatgaacccc
aagacggccaacgtgccgcagaccgtgcccatgcggcttcgcaagctgcccgactccttc
ttcaagccgcctgagcccaagtcccactcgcgacaggccagtactgatgcgggtactgcc
ggagctctgactccacagcatgttcgagctcactcctcaccagcctccctgcagctgggt
gccgtttctcctgggacactcaccgccagtggcgttgtctctggccctgccgctacccct
gcagctcagcatctccggcagtcctcctttgagatccctgatgatgtaccactgccagca
ggctgggagatggccaagacatcttctggtcagagatacttcttaaatcacaacgatcag
acaacaacatggcaggacccccggaaggccatgctctcgcaactgaacgttcctgcgcct
gccagcccagcggtgccccagacgctgatgaattctgcctcaggacctcttcctgatgga
tgggagcaagctatgactcaggatggagaagtttactacataaaccataagaacaagacc
acgtcctggctggacccaaggcttgaccctcgttttgccatgaaccagaggatcactcag
agtgctccagtgaagcagcccccacccttggctccccagagcccacagggaggtgtcctg
ggtggaggcagttccaaccagcagcagcaaatacagctgcagcagttacagatggagaag
gagagactgcgattgaaacaacaggaattatttcggcaggcaatacggaatatcaatccc
agcacagcaaatgctccaaaatgtcaggaactagctctgcgcagccagttgcctgcactg
gagcaggatggaggaactcagaatgcagtatcttctcccgggatgtctcaggaattgagg
acaatgacaaccaatagttcagatccctttcttaacagtggcacctatcactctagagat
gagagcacagacagcggcctcagcatgagcagctacagcatccctcggaccccagatgac
ttcctgaacagtgtggatgaaatggatacaggagacaccatcagccaaagcaccctgccg
tcacagcagagccgcttccccgattacctggaagccctccctgggacaaatgtggacctt
ggcacactggaaggagatgcaatgaacatagaaggggaggagctgatgcccagtctgcag
gaagcgctgagttccgaaatcttggacgtggagtctgtgttggctgccaccaagctagat
aaagaaagctttctcacgtggttatag

DBGET integrated database retrieval system