KEGG   Mus pahari (shrew mouse): 110320097
Entry
110320097         CDS       T05929                                 

Definition
(RefSeq) high affinity immunoglobulin gamma Fc receptor I
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04145  Phagosome
mpah04380  Osteoclast differentiation
mpah04613  Neutrophil extracellular trap formation
mpah04640  Hematopoietic cell lineage
mpah04666  Fc gamma R-mediated phagocytosis
mpah05140  Leishmaniasis
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110320097
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    110320097
   04613  Neutrophil extracellular trap formation
    110320097
   04666 Fc gamma R-mediated phagocytosis
    110320097
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110320097
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110320097
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110320097
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110320097
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110320097
   05152 Tuberculosis
    110320097
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110320097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110320097
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110320097
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    110320097
CD molecules [BR:mpah04090]
 Proteins
  110320097
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set
Other DBs
NCBI-GeneID: 110320097
NCBI-ProteinID: XP_021051658
Ensembl: MGP_PahariEiJ_G0026821
LinkDB
Position
4
AA seq 405 aa
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTMWCEGPHLPG
DSSTQWFINGTAIQISTPSYSIPEASFQDSGEYRCQRGSSMPSDPVQLQIHSDLLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSGSEVVILKTNLNHNGIYHCSGM
GRHRYTSAGVSITVKELFTTPVLRASLSSPFPEGSLVTLNCETNVLLQRPGLQLHFSFYV
GSKILENRNTSSEYRIPRAEREDAGFYWCEVATEDGSVLKHSPELELQVLGPQSSAPVWF
HILFYLSVGIMFLVNTVLYVKIHRLQREKKYSLEVPLVSEQGKKATAFQQVRSDGVVYEE
VPATASQATPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggctactaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactatgtggtgtgaggggcctcacctgcctgga
gacagttctacacaatggtttatcaacgggacagccattcagatctccacgcctagttat
agcatcccagaggccagtttccaggacagtggtgaatacaggtgtcagagaggttcctcg
atgccaagcgaccctgtgcagttgcaaatccacagtgatctgctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataag
ctggtgtacaacgtggttttctatcgaaatggaaaatcctttcagttttcttcaggttct
gaggtcgtcattctgaaaaccaacctgaatcacaacggcatctaccactgctcgggcatg
ggaagacaccgctacacgtctgcaggagtttccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcgtccttgtcatctcccttcccggaggggagtttggtcaccctgaac
tgtgagactaatgtgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagaacaggaacacatcctcagagtaccgtataccaagggcagaa
agagaagatgctggattctactggtgtgaggtagccacggaggacggcagtgtccttaag
cacagccccgagttggagctccaagtacttggtccccagtcatccgctcctgtctggttt
cacatcttgttttatctgtcagtgggaataatgtttttggtgaacacggttctctatgtg
aaaatacacaggctgcagagagagaaaaaatacagtttagaagtccctttggtctctgag
caggggaagaaagcaactgcctttcagcaagttagaagcgatggcgtcgtgtatgaagaa
gtaccagctactgcaagccaggctacaccaaaagaagctcccgacggacctcgaagctca
gtgggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtaccggggca
caaacttcccaaagttga

DBGET integrated database retrieval system