KEGG   Mus pahari (shrew mouse): 110320382
Entry
110320382         CDS       T05929                                 

Gene name
Sox2
Definition
(RefSeq) transcription factor SOX-2
  KO
K16796  transcription factor SOX2 (SOX group B)
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110320382 (Sox2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110320382 (Sox2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110320382 (Sox2)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    110320382 (Sox2)
SSDB
Motif
Pfam: SOXp HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 110320382
NCBI-ProteinID: XP_021052020
Ensembl: MGP_PahariEiJ_G0026373
LinkDB
Position
4
AA seq 319 aa
MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRK
MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
LMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQL
GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG
SMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHY
QSGPVPGTAINGTLPLSHM
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtataacatgatggagacggagctgaagccgccgggcccgcagcaagcttcggggggc
ggcggcggaggaggcaacgccacggcggcggcgaccggaggcaaccagaagaacagcccg
gatcgcgtcaagaggcccatgaacgccttcatggtatggtcccgggggcagcggcgtaag
atggcccaggagaaccccaagatgcacaactcggagatcagcaagcgcctgggcgccgag
tggaaacttttgtcggagacggagaagcggccgttcatcgacgaggccaagcggctgcgc
gctctgcacatgaaggagcacccggattataaataccggccgcggcggaaaaccaagacg
ctcatgaagaaggataagtacacgcttcccggaggcttgctggcccccggcgggaacagc
atggcgagcggggttggggtgggcgccggcctgggtgcgggcgtgaaccagcgcatggac
agctacgcgcacatgaacggctggagcaacggcagctacagcatgatgcaggagcagctg
ggctacccgcagcacccaggcctcaacgctcacggcgcggcacagatgcagccgatgcac
cgctacgacgtcagcgccctgcagtacaactccatgaccagctcgcagacctacatgaac
ggctcgcccacctacagcatgtcctactcgcagcagggcacccccggtatggcactgggc
tccatgggctctgtggtcaagtccgaggccagctccagcccccccgtggttacctcttcc
tcccactccagggcgccctgccaggccggggacctccgggacatgatcagcatgtacctc
cccggcgccgaggtgccggagcccgctgcgcccagtagactgcacatggcccagcactac
cagagcggcccggtgcccggcacggccattaacggcacactgcccctgtcgcacatgtga

DBGET integrated database retrieval system