KEGG   Mus pahari (shrew mouse): 110320476
Entry
110320476         CDS       T05929                                 

Gene name
Mcl1
Definition
(RefSeq) induced myeloid leukemia cell differentiation protein Mcl-1 isoform X1
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04630  JAK-STAT signaling pathway
mpah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320476 (Mcl1)
   04151 PI3K-Akt signaling pathway
    110320476 (Mcl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110320476 (Mcl1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110320476 (Mcl1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110320476
NCBI-ProteinID: XP_021052170
Ensembl: MGP_PahariEiJ_G0026793
LinkDB
Position
4
AA seq 332 aa
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARP
PPVGAEDPDVTASAERRLHKSPGLLAVPPEEMASTAAAAAIVSPEEELDGCEPEAIGKRP
AALPLLELVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKP
LGEAGAAGRRALETLRRVGDGVLRNHETAFQGMLRKLDIKSEDDVKSYSRVMIHVFKDGV
TNWGRIVTLISFGAFVAKHLKSINRESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEF
FHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgtttggcctgcggagaaacgcggtcatcggcctgaacctgtactgcggcggcgccagc
ctcggcgcgggcggcggttccccggcaggggcgcgtctggtggccgaggaggccaaggcg
cggcgcgaggggggaggggaggccgccctgctgcccggcgcgcgggtggtcgcccggccg
ccgcccgtgggcgccgaggaccccgacgtcaccgcgtcggccgaaaggcggctgcacaag
tcgcccggcctcctcgccgtgccgcccgaagagatggcctccacggccgccgccgccgcc
atcgtgtctcccgaggaggagctggacggctgcgagccggaggcgatcggcaagcgcccg
gccgcgctgcccctcctggagctcgtgagcgaggcggccaagagctccggggccgacggc
tcgctgccctccacgccgccgccgcccgaggaggaagaggacgacctgtaccgccagtcg
ctggagatcatctcgcgctacttgcgggagcaggcgaccggctccaaggactcgaagcct
ctgggcgaggctggcgcggcgggccggagggcgctggagaccctgcggcgcgtgggcgac
ggcgtgctgcgcaaccacgagacggccttccagggcatgctccggaagctggacattaaa
agtgaagacgatgtgaaatcttattctcgagtaatgatccatgttttcaaagatggcgta
acaaactggggcaggattgtgactcttatttctttcggtgcctttgtggccaaacactta
aagagcataaaccgagaaagctgcatcgaaccattagcagaaagtatcacagatgttctt
gtaaggacgaaacgggactggcttgtcaaacaaagaggctgggatgggtttgtggagttc
ttccacgtacaggacctagaaggcggcatcagaaatgtgctgctggcttttgcgggtgtt
gctggagtaggggctggtctggcatatctaataagatag

DBGET integrated database retrieval system