KEGG   Mus pahari (shrew mouse): 110320813
Entry
110320813         CDS       T05929                                 

Gene name
Dchs2
Definition
(RefSeq) protocadherin-23
  KO
K16507  protocadherin-16/23
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110320813 (Dchs2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110320813 (Dchs2)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Cadherin related
   110320813 (Dchs2)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_3
Other DBs
NCBI-GeneID: 110320813
NCBI-ProteinID: XP_021052587
Ensembl: MGP_PahariEiJ_G0026550
LinkDB
Position
4
AA seq 3345 aa
MGEGRQPAGSPRGRPRGAGAQSSLLRLFVHALLWAASGSSAQVFNLSLSVDEGLPPDTLV
GDIRAGLPVAQQQEGNGFFLSEDSDDSPLLDDFHVHPDTGIIRTARRLDRERRDHYSFVA
ATLLGEVVQVEIRVNDVNDHSPRFPRDSLQLDVSELSPPGTAFRLPGAQDPDAGLFSIQG
YTLLQASDQPQDPAGPFFQLRYGTPGLPASPSLSVSSSPLEPLDLVLLRRLDRETAAAHE
LHIEAWDGGSPRRTGLLHVQLRVLDENDNPPVFEQGEYRAAVREDAQPGAEVCRVRATDR
DLGPNGLVRYSIRERQVAVAGAGGGPPSDLGYFSVEELSGIVRVQRPLDREEQAWHQLVI
QARDGGAEPEVATVRVSIDVLDVNDNPPAIHLLFLTEGGAAHVSEGAQPGDYVARVSVSD
ADGDPENEEEVAGMLDARLLGAGSIKLSLEGGNGVFALRPGGPPGVFFLCIEGLLDRESK
DLYELRLVATDAGSPPLSTEESLLLWVSDLNDQPPVFSQEHYWASVSEAAVPGTSVVWVS
ALDADQAGTDHARLRYELVQLSDPCETEALSPEAECVPSFSINPNNGLISTIRALDREVQ
ETVELRVVAQDLGEPPLSATCLVTITVDDVNDNEPVFWRQVYNVTLAEHAAVGHCFLQVK
ASDADAGLYGLVEYSLYDGFQSYEAPPAFQIDPQDGRICVSQDIDRERDPGTFDLLVKAK
DGGGLSAQAFVRVEVDDVNDNYPVFTPSTYVTSISGQTPPGTEIINVLASDRDSGIYGTV
AYELIPGDQSSLFTIDSTTGIIYLTSTLSHLEATTVFLMVCARDGGGLTAGTNADVTVHI
MQTTLAPAEFERPKYTFSVYEDVPEDTLVGTVKARESLNSSEPITYRISSGDPEGKFSIH
RWLGSICTLKPLDHEAQPMVVLTVQAQLGSSPACSSTEVNITVMDVNDNRPEFPTASDEI
RISQTTPPGTALYLARAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGGQAD
FRLTLVAKDQGVPPQASQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQA
YPLYPWRPASKKTVYSLDVSVDSAVFGIHPHTGWIYLRRQLDYESTETYKFRVYAHTSGD
RSLRNVMRNVSTSVIVHVLDENDHAPAFRQNRVFLNIEESPLPLGVIGKMTAIDADSGKN
GQLSYFLLTDGKFFKMNPNTGELINWLALDREHQGHHQMTILVTDHGSPPQNATMLVYVT
ITDINDNRPFFPQCLPGKEFHFKALEGQPVNTLVTTVFAKDLDEGLSAELTYSISSEDYP
AHFKIDANNGEIRTTTILSYDYRPSYRMTVIASDHGVPPLQGQAIINIQVIPLSKGRVFM
SQNIRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSFVAEDKDDHFEIDSSTGDLFL
TKELDYEMTSHYLIRVISKDHSQSPAWNSTVFLSIDVEDQNEHSPSFQDEVIVISIEENV
PVGTPVYVFNAKDGDGSFLNSRIQYFAESSYVGVNPFLIHPSSGALVTASLLDRENVPTF
ILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYVREDAEVGAVVHRINA
EDPDAEMNGEVVYSILSGNEDMVFVLDSSSGLLRTACPLDYEVKSQHTLTLVAHDGGTPA
RSSSQTLTVTVLDVNDETPVFKQLLYETSVKENQSPGVFVTRVEAEDTDSGVNSKHQFEI
LPGPAFGLFEINPDTGEVVTTVTFDREAQGIFRLRVLVRDGGVPSLSSTAAIICTIEDEN
DHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVTYHIAEGNTDEYFAIHTTSG
ELSTTRALDREQVSNFTLTILCSDLGSPPRSSAMQLHIRVLDDNDHSPAFPMLQYQSSVR
EDAEVGTVVLVLSAIDRDEGLNGQVEYFLMEEASGAFTIDHVTGTLRTSHTLDREARSQH
TFQAVARDCSIQGAKSSVLSILIDVTDANDNDPVWEENPVDAFISPMLALNQTIVHLRAS
DPDAGPNGTVIFSFVDRQSMFSIDGYTGEVKLQQKPSSEHFPIWVQLLAADQGTPARTTM
GLLVVHMEGEGVKLSFSHYLYTGLVTENCEPGTSVVTVKAFAPVSSPGSITYSVFSGNED
GVFSLGSNSGQLIVEEPRLLDCEVRSEVQLIILAENNRHKAFTTVAVSIQDRNDNPPRFA
QSVYQASVSEGQFYNAHVIQVSATDLDRGLNSQIEYSIVSGNQAGAFRIDELSGVILTNS
ILDYESTSSYSLIVQATDRGVPRLSGTALVKIQVTDINDNAPVFLLSEAVEITENSLPGV
IVARVSVHDADLNPAFTFSLVKESSSAAKFAISQDTGVVVLARTLDFEEVTEYELIVRVS
DSVHHTEGSLIIRVLDVNDNPPVFTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYR
ILSPPEGFAIDPRNGTIFTTDSVSLPEKIPTLRFLVEASDGGIPSLTALTLVEIDIQDVN
NYAPEFTAECYNLSLSEDAPIGSTLMTFSTIDRDYSLENKHTEYSIISGNFHGYFHVETS
LLGSEHPPRQSGALVLFRALDREASASHKLVLLASDHGCPPLSSTSVIAIEVLDINDNAP
TFGSRRYHAHVKESTPVGSHVTMVSADDRDAGSHAEIIYGITSGNEKEHFYLEDRTGVLY
LVKPLDYEETIAFTLTIQATDEEEKHVSFAAVHISVLDDNDHSPQFLSSTLACITPENLP
PLSIICSVHALDFDAGPYGEVTYSIVSPCLATHGMHPYQDLFVIDPLTGDIHTEQMLDYE
SVREHCLLIQARDRGDASASLEVWVEVEGVDEFEPIFTQDQYFFSLPEKGQGQQLIGRVE
ASDADAGVDGVVLYSLRTPSTVLSVNKTNGNIYWVRAPLLISSQLNKEDTLEVKIIAHSP
KPGSKSTSCSVFVNVSLPAVGHHRTVLVHSFSISLVVSLLVFLSLVCTLIVLILRHKQKD
PLHSYEEKKAPSSPDADPKLTGAASELKAGQETAEYKGMTGPGEVMPTEWLNLMSVMEKD
IIHLFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDSALSDRGSRVPDSGIPRDSDQ
LSCLSGETDVMTSSEVMEASHMFEEGVGGEGCDIIYVQNNALSPRREVTAGVLAESRKES
FTSGSQEGRCVAPSTQMTSADDVRGSFAWDYFLSWEPKFQHLASVFNDIARLKDEHLQVP
GIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFSRSPLPYHGGSLPEAMTP
NFSPSLSLLTMQTPARSPVLPEGESRGTHMLCTWHDKKAEDELQG
NT seq 10038 nt   +upstreamnt  +downstreamnt
atgggtgaagggcgtcagccggcggggtcaccccgtgggcggccccgcggcgccggggcg
cagagctccctgctccggcttttcgtccacgccttgctgtgggcagcctcgggctcatct
gcccaggtgttcaacctcagcctctcggtggacgaggggttgcccccggacacactggtg
ggtgacattcgcgcggggttgccagtagctcagcagcaggaagggaatggcttttttctg
tcggaggactctgatgactccccgctgctggacgacttccacgtgcacccggacactggt
atcatccgcaccgctcggcgtctggaccgcgagcggcgggaccactacagcttcgtggcc
gccacgctgttgggagaggtggtgcaggtggagatccgcgtcaacgacgtgaacgaccat
tcgcctcgctttccccgcgactccctgcagctggacgtgtcagagctcagccctccgggg
acagcgttccgcctgccaggcgcccaggacccggacgcggggctgttcagcatccagggc
tacaccttgctgcaagcttccgaccagccccaggaccccgcaggacccttcttccaattg
cgctacgggacgccggggttaccggcgtcgccttccctgtccgtgtcctcatcacctctg
gaacccttagacttggtgctgctgcggcgcttggaccgagagacggctgcggcgcacgag
ctgcacattgaagcgtgggacggtggcagccctcggcgcaccggccttctgcacgtgcag
ctgcgtgtgttggatgagaacgacaacccgccagttttcgagcagggcgagtaccgcgcc
gcagttcgggaggacgcccagccgggcgctgaggtttgtcgcgtgcgtgccaccgatcgt
gacttgggccccaatggtttggtacgctacagtatccgggagcggcaagtggccgtggcg
ggcgcaggtggcgggccaccgagcgatctgggctatttctctgtggaggagctgagcggc
atagtgcgggtgcaaagacctttagaccgggaggagcaggcttggcaccagctggtgatc
caggcccgcgacgggggcgctgagccagaggtagccaccgtgcgcgtgtccattgacgtg
ctggacgtgaatgacaaccctcctgccatccacctgctctttctcaccgagggaggtgcg
gcccacgtctctgagggcgcccaaccaggcgactacgtggctcgagtctcggtgtccgat
gccgatggtgacccagagaatgaagaggaggttgcagggatgcttgatgcacgcctcctt
ggggcaggcagcatcaagttgtccttggaaggtgggaacggagtctttgcgctgcggccc
ggtggtccacctggagtatttttcctttgcatcgagggactcttggacagggaaagcaaa
gatttatacgagttaagactagtggccactgatgcagggtccccaccactgagcacggag
gagtcgctgttgctctgggtctcggacctcaatgaccagccacctgtctttagccaagag
cattactgggcctcggtgtctgaagccgctgtccctggcacctcggtagtttgggtcagc
gctttagatgctgaccaggcgggcaccgatcacgccaggctgcgatatgagctagtgcaa
ctctcggatccctgcgagactgaagctctgtcacctgaggcagagtgtgtgccatccttc
agcatcaatcccaacaacggtttgatcagcaccatccgagctctagacagagaggtccag
gagacagtggagctgagagtggtggcccaggaccttggagagccgccactttctgccacc
tgtctggtgaccattaccgtggatgacgtgaatgacaatgagcccgttttctggaggcag
gtgtataatgtcacccttgcggagcatgctgcagttggacattgctttctgcaggtaaaa
gcctcggatgcagatgcaggactctacggcttagtcgagtattcgctttatgatggattc
caaagctacgaagcacctcctgcattccagatcgacccgcaggatggccgcatttgtgtg
tcccaagacatagacagggaaagggatcccggcacctttgatctgctggtaaaagctaag
gatgggggtggtcttagtgcccaagcttttgtccgggttgaagtggatgatgtaaatgat
aattaccctgtcttcactccatcgacctatgtgaccagcatcagtggccagaccccacca
ggaactgagatcatcaacgttcttgccagtgacagagattctggaatatatggaacagtg
gcttatgaactcatcccaggagatcagtcgtctctcttcaccattgactctactacaggg
attatttacttaacatcaacgctcagccatttggaagccaccaccgtttttctgatggtc
tgtgctcgagatggtggcgggctcacagctggcactaacgctgatgtcaccgtccacatc
atgcagaccacgctggctcctgcagagtttgaaaggcccaagtacaccttctcagtttat
gaagatgtgccagaagacacgcttgttgggacagtgaaggcaagagagtccttgaattcc
tcagagccaatcacgtatcgaatttcctctggcgatccggaaggaaagttctccattcac
agatggctgggcagtatctgcaccctgaagcctctggaccacgaggcacagcccatggtt
gtcctcacggtccaggcacagctcggcagctccccagcctgcagcagtacagaagtgaac
attacggtgatggatgttaatgacaaccgccctgagtttcccacagcctcagatgagatt
aggatctcccagaccactccgcctggtacagccttgtaccttgcacgtgcgcaggataga
gacagcgggctgaatggactggtccggtacagcatcgcaagtccccagccaagcgaattc
agcatggaccaaggccgcggggtgctgtacctcagggagagtctgggaggccaggcagac
ttcaggctgactctcgtggctaaggatcaaggtgttcctccccaggcatcccagttggta
ctcacagtagttattgaaagtcaagaacgaatcccagccgtggcttttgaaaatttggtc
tatcaagtagaagttagtgagtctctcccactgacgactcaaatcctacaggtacaggcc
taccctctgtatccgtggcgcccagcctcgaagaagaccgtctactccctggatgtcagc
gtggactctgcagtgtttggaatccaccctcacactgggtggatttatctacggcggcag
ctagactatgagtctacagagacatacaagtttagagtgtatgcgcacacctcaggggac
agatcgctgcggaatgtgatgcggaacgtgagcacttcggtgatagttcatgtcctggat
gagaacgaccacgccccagccttccggcagaacagggtgtttctgaacattgaggagagc
cctctccccctaggggtaatagggaaaatgacagccatcgatgctgactctgggaagaac
gggcagctctcctatttccttctgaccgatggaaaattcttcaagatgaatcctaacaca
ggtgagctgatcaattggttggcactggatcgtgaacatcaggggcatcatcaaatgact
atcctagtgacagaccacggctccccaccacagaatgccaccatgctggtttatgtcaca
attactgacatcaatgacaacaggccctttttccctcagtgtctcccgggaaaggaattt
cacttcaaggctttggaaggtcagccagtcaatacattggttacaactgtctttgcgaag
gatctcgacgaaggactcagtgcagaacttacatactccatctcgtcagaggattaccct
gctcactttaagattgatgcaaacaatggtgagataagaacaaccacgatcctttcatac
gactacagaccttcctataggatgacagtcatcgccagtgaccatggggtgcccccactt
caaggacaggcaattattaacattcaggtgataccactctccaaagggagggtttttatg
tctcagaatatccgacatttagttatcccagaaaatacgaagccttcaaagatcatgagc
ctgatgaagtcacccgatccccttcaacaggaccatggtgggaagttacacttcagtttt
gttgctgaggacaaggatgaccactttgaaattgacagctcgacaggagatttgttccta
actaaggaacttgactatgaaatgacatcccattatcttatcagggtgatttctaaagat
cacagccaaagccctgcctggaacagcacagtcttccttagcattgatgtggaagaccag
aatgagcattccccatccttccaggatgaggtcattgtgataagcatagaggagaatgtc
cctgtagggactccggtgtatgtgttcaatgccaaagatggcgatggcagttttctgaac
agtaggatacaatactttgcagaatccagctatgttggagtgaacccatttctcatccac
ccctcctctggtgcattggtcactgcatctcttctggatagagaaaatgttccaactttc
atcctaaccgtaactgcatcagatcaggctgtgaatgtgacagatcggcgatggaggaca
ctggtagcagaagtggtgattttggatgtgaatgaccacagccccaccttcgtgtcctat
cccatcacctatgtgagagaagatgctgaagtaggtgctgtggtacaccgcataaatgcc
gaggatccagatgcagagatgaatggagaagtagtgtacagcatcctctcaggaaatgaa
gacatggtcttcgtgctagacagctcatcaggcttgctgaggacagcctgtcctttggat
tacgaagtgaaatctcagcataccctgaccctcgtggcccatgatggtggcacgccagca
cgttcttcatcccagactctgacggtcactgtccttgatgtaaatgacgagacaccagta
tttaagcaacttctgtacgaaacttcagttaaagaaaaccaaagtccaggagtgtttgtt
acaagggttgaagctgaagacacagattcaggagtcaattccaaacatcagtttgaaatc
ctgccagggcctgcctttgggttgtttgagatcaatcctgacacaggagaggtggtgaca
actgtcacgtttgacagggaagctcaaggaatcttcaggcttcgagtactcgtgcgagat
ggtggtgtcccttcattgtccagcacggcggccatcatctgcaccattgaagatgaaaat
gaccatgccccggagtttattgtcctccatcatgacattgaaatcctagaaaaccgagat
ccagaggttgtgtacactgtgctggcttttgatatggatgctggcaacaatggagctgtc
acctatcacatagcggaaggaaataccgatgagtattttgcaatccatacaacctcagga
gaactctcaacaactcgtgctttggaccgggagcaggtcagcaattttaccctcactatc
ttgtgctcagacttggggagcccgccccgaagctctgcaatgcagctgcatattagagtt
ttggatgacaacgaccacagccccgcttttcctatgttgcagtatcagtcctccgtgaga
gaagatgcggaggtgggcaccgtggttctggtgctgtctgccatagacagagatgagggt
ctcaacgggcaggtggaatattttcttatggaggaagcttctggcgccttcactattgat
catgtaacagggaccctgagaactagccacacccttgatcgagaagccaggtctcaacac
acgttccaggcagtggccagagactgcagcattcaaggtgcaaaaagcagcgtgctctcc
atactcatagacgtcacggatgctaatgacaatgatcctgtttgggaagagaacccggtt
gatgctttcatttcccccatgctggccctaaaccagaccattgttcatctgagagccagt
gacccagatgcagggcccaatggaactgttattttcagttttgtagaccgccagtccatg
ttttccatcgatggatatacaggagaagttaaactacagcagaaaccatcttcagaacac
tttcctatctgggtgcagctattggccgcagatcaagggaccccagcaaggacaaccatg
ggcctcttggttgtccacatggaaggagaaggtgtgaaactgtccttcagccactatctc
tatacaggactcgtgactgaaaactgtgagccaggtacctctgttgtgactgtaaaggcg
tttgctcctgtgtcaagtccaggctccattacatactctgtttttagtgggaatgaagat
ggagtgttctccctgggctccaactcaggacaactcatcgtggaagagcctagattgctt
gattgtgaagtcaggagtgaagtgcagctcatcattcttgctgagaacaataggcataaa
gctttcaccacagtagcagtttccatccaggacaggaatgataatcctccacgctttgca
caaagtgtataccaagcatcggtgtctgaaggacagttctacaatgctcatgtcatacag
gtgtccgctactgacttggacaggggcttgaacagccagatcgagtattccattgtctct
gggaaccaagccggagccttccggattgacgagctgagcggagtgatcctgaccaactcc
atcctggactatgagtccaccagctcctacagcttgattgtacaagccacagacagaggg
gtgcccaggctttctggtacagctctggtcaagatacaggtgactgatataaacgacaat
gccccggtctttctcctctcagaagcagtagaaattacagaaaattctttgcctggtgta
attgtggctcgggtatccgtccatgatgcggatctgaatccagctttcaccttcagtctt
gtcaaagaaagcagctctgcagccaaattcgctatcagtcaggacactggagtggtagtg
ctggcgcgtacactggattttgaagaagttaccgaatacgagctgatcgtccgtgtttct
gattcagtgcaccacacagagggttccctcatcatccgtgtgctggatgtcaatgataac
ccacccgtttttactcaagatttctaccaggctgcagttcctgaactcacgcctggaggg
tacttggtgctgaccctgtctgccaccgacttagaaagcagtggagacatttcttaccgg
atcctttcccctcctgagggattcgccatcgaccccaggaatggcaccatatttactact
gattctgtatcacttccggaaaagataccaacacttcggtttcttgttgaagccagcgat
ggtgggattccctccttgacggctctcacgttagtggagatagatatacaagatgtgaac
aactatgccccggagtttacagcggagtgctataatcttagcttgagtgaagatgccccc
atcggaagcaccctcatgacgttttcaactatcgaccgtgactactctttggaaaacaaa
cacaccgagtattctatcatcagtggcaactttcacggctacttccacgttgaaaccagc
ctccttggttcagaacatcccccccggcagagcggtgctcttgtgttgtttcgtgctctg
gacagagaagcgagtgccagccacaagcttgtgcttcttgcgtctgaccacggctgccct
ccactgagctccacaagtgtcatagcaatagaagttctcgatatcaatgacaacgcaccc
accttcggcagtcggcggtaccacgcccatgtcaaggaaagcaccccggtagggagtcat
gtcaccatggtatcggcagatgaccgtgacgcaggttcacatgcagaaatcatctatggc
ataacctctggaaatgaaaaagaacatttttacttagaagacagaactggggttctttat
ttggtgaaacctctggattacgaggaaacaatagcattcactttaaccatccaagccaca
gatgaggaggagaaacacgtctcttttgctgctgtgcatatcagtgtgttagatgacaat
gaccactcacctcagtttctgtcctctaccttggcctgcatcactcccgagaaccttcct
cctctctccatcatatgttctgtgcacgccctggattttgatgcgggaccttacggggag
gtgacttactctattgtgtcaccatgtcttgccacgcatgggatgcatccttatcaggat
ctctttgtcatcgatcctttgacaggggacattcacactgagcaaatgctcgactatgaa
agtgtcagggagcactgcctcctgattcaggccagagacagaggtgacgcgtcagcttcc
ctggaggtctgggtggaagttgaaggggtagatgagtttgaacccatttttactcaagat
caatattttttcagtctccctgagaagggtcaaggacaacagctgattggcagagtagag
gcctcggacgcagatgctggtgtggatggagtggtgctctactctcttaggactccatcc
actgtcttgtcagtaaacaaaacgaatggcaacatttactgggttagagctcctctccta
ataagcagtcagctcaacaaagaagacactctggaagtgaaaataattgctcacagcccc
aagccgggctctaagtccacatcctgcagtgtgtttgtgaatgtctctttgccagccgta
ggacaccatagaacagtactggttcacagtttctccatcagccttgtggtctccttgtta
gtgttcctctcgcttgtctgcactctaattgtactgattttaaggcataagcaaaaagac
ccactacacagctatgaggagaagaaggccccatcatccccagatgctgatcccaaattg
actggggctgcaagtgagctcaaggctgggcaggagactgccgagtacaagggtatgaca
gggcctggtgaagtcatgcctaccgaatggttgaacttaatgagtgtcatggagaaggac
attatccacctattcaggcactcaaactacagtggccactgctctgtggatggagaaact
gcagaagataaagaaatccagaggataaatgagaatccttatagaaaggactcagactct
gccctgagtgaccggggttccagggtgccagactcgggcatccctagggactctgaccag
ctttcttgcctgtcaggagagacagatgtgatgactagttctgaggtaatggaagccagc
cacatgtttgaggaaggagttggaggggaaggctgtgacataatctatgttcaaaataat
gcattatcccccagaagagaggtgacagcaggtgtcttggctgagagcaggaaagagtcc
ttcacttcaggcagtcaggaaggaagatgtgtagctccttccactcagatgacttctgct
gatgatgtcagaggcagctttgcctgggattacttcctcagttgggaacccaagttccag
catcttgcctcagtgtttaatgatattgccagactaaaggatgaacatttgcaggtgcct
ggcattccaaaagacacatcttttgttttcccaccccccttgatcacagcagtagcacag
cctgggatcaaggcagttcccccacgaatgccagccatcaccctgggccaagttcttccg
aaattctcccgttctccccttccctaccatggtgggtctctaccagaagccatgactccc
aacttctctccatctctttccctactgacaatgcagacccctgccaggtcaccagtgttg
ccagagggagaatctagaggaacgcacatgctttgcacatggcatgacaagaaagctgaa
gacgaacttcaaggatag

KEGG   Mus pahari (shrew mouse): 110326393
Entry
110326393         CDS       T05929                                 

Gene name
Dchs1
Definition
(RefSeq) protocadherin-16
  KO
K16507  protocadherin-16/23
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    110326393 (Dchs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110326393 (Dchs1)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Cadherin related
   110326393 (Dchs1)
SSDB
Motif
Pfam: Cadherin Cadherin_3 Cadherin_4
Other DBs
NCBI-GeneID: 110326393
NCBI-ProteinID: XP_021060458
Ensembl: MGP_PahariEiJ_G0013455
LinkDB
Position
1
AA seq 3291 aa
MQKELSVALSCPGMKSLRTLLPLLVLLGATVPGSWGQAGSLDLQIDEEQPAGTLIGDISA
GLPPGTAPPPMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDRERRDLYRFTAVTPDGAT
VEVTVRVADINDHAPAFPQARETLQIPEHTALGTRYPLEPARDADAGRLGTQGYALSGDG
AGETFRLETRPGPGGAPVPELVIAGELDRENRSHYMLQLEAYDGGSPPRRAQALLDVTLL
DINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGANGAVTYEINRRQSEGDGPFS
IDAHTGFLRLERPLDFEQRRVHELVVQARDGGDHPELGSAFVTVHVRDANDNQPSMTVIF
LSADGSPRVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSVIYLVCV
ARRLDREERDVYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPEPLPEVA
LPGSFVVRVTARDPDQGTNGQVTYSLAPGTHTHWFSIDPTSGIITTAATLDYELEPQPQL
IVVATDGGLPPLVSSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQVTATDAD
SGPFGLLSYSLGAGLGASGSPPFRIDAHSGDVCTTRTLDHDQGPSSFDFTVTAIDGGGLK
SMVYVKVFVADENDNPPQFYPREYAVSLSAQSTPGTAVLRVHAHDPDQGPHGRLSYHILA
GNSPPLFALDAHSGLLTVAWPLGRRANSVVQLEIGAQDGGGLQAEPIARVNISIVPGTPT
PPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLGPVTLTLSGGDPRGLFSLDSPSGIL
KTLRPLDRELLGPVLELEVRAGSGIPPVFAVARIRVLLDDVNDNSPAFPAPEDTVLLPQN
TAPGTPVYTLRALDPDSGANSRVTFSLLAGGDGLFTVDPTTGHIQLMGPLGPPGGPAHEL
EVEARDGGSPPRTSHFRLRVVIQDLGIHGLAPRFDSPTYRVDLPSGTTTGTQILQVQAQA
PDGSPVTYHLAADGANNPFGLESQSGWLWVRTALDRESQELYTLKVMAVSGSKAELGQQT
GTATVRVIILNQNDHSPRLSEEPTFLAVAENQPPGTSVGRVFATDRDSGPNGRLTYSLQQ
LSEDTKAFRIHPQTGEVTTLQTLDREQQSSFQLLVQVQDGGSPPRSATGTVHVAVLDLND
NSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPGSELFSL
HPHTGELHTAASLVRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSTRMVESPDLIEA
DSAATVPVVLTVTAAEGLRPGSLLGSVAPQEPASVGVLTYTLVGGADPEGTFALDSTSGR
LYLARPLDFEAGPAWRALTVRAEGPGGAGARLLRVQVRVQDENEHAPTFARDPLALALPE
NPDPGATLYTFRASDLDGPGPNSEVRYRLLRQEPPVPALRLDARTGALSAPRGLDRETTP
ALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPPGPAALHV
VARDPDLGEAARVSYRLAAGGDGHFRLHATTGALSVVRPLDREQRAEHVLTVVALDHGSP
PRSSTQLLTVSVVDVNDEAPVFPQQEYNVILRENSPPGTFLLTLKATDPDLGANGQVTYG
GVSGESFSLDPNTGVLTTLRALDREEQEEINLTVYARDRGLPPLLTHITVRVTVEDENDH
TPTFGNTHLSLEVPEGQDPQTLTTLRASDPDGGLNGQLQYRILDGDPSGAFALDLTSGEF
GTMRPLDREVEPAFQLQIEARDGGQPALSATLLVTVTVLDANDHAPVFPVPSYSVEVPED
APVGTLLLQLQAHDPDDGDNGRVMYYLGAGTAGAFLLEPTSGELSTATALDREHCASYAF
SVTAVDGAAAGPMSTTVPITIIVRDVNDHAPAFPTSPLRLRLPRPGPSLNKPTLALATLR
AEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFVVATDLGRPA
RSATGVVVVGIQGEPERGPRFPRASNEAVLRENAPPGTPVISPKAVHSGGSNGPITYSIL
SGNERGIFSIQPSTGTITVRSAEGLDFETSPRLRLVLQAESGGAFAFSVLTLTLQDANDN
APRFLRPHYVAFLPESRPLEGALLQVEADDLDQGSGGQISYSLAASQPARGLFHVDPATG
TITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQPWELRVSE
DALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSIGRYGGRVSLTGPLDFEQCDHYHL
QLLAHDGPHEGHANLTVLVEDVNDNVPTFSQSLYQVMMLEHTPPGSAILSVSATDRDSGA
NGHISYHLASPTEGFRVDPNNGTLFTTVGAMALGHEGPGVVDVVLEARDNGAPGRTAQAT
VHVQLKDQNDHAPSFTLPHYRVAVSEDLPPGSTLLTLEATDADGSRTHATVDYSIISGNR
GRVFQLEPRLAEVGDSVGPGPQALGCLVLLEPLDFESLTQYNLTVAAADRGQPPRSSAVP
VTVTVLDVNDNPPVFTRASYRVTIPEDMPVGAELLHVEASDADPGPHGLVHFTLSSGDPL
GLFELDENSGALRLAHPLDCETQARHQLVVQAADPAGTHFALVPVTVEVQDVNDHGPAFP
LSLLSTSLAENQPPGTLVTTLHAIDGDAGTFGRLRYSLLEAVPGPEGREAFSLNSSTGEL
RARVPFDYEHTGSFRLLVGAADAGNLSASVTVSVLITGEDEYDPVFLAPSFHFQVPEGAQ
RGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSGTTTSGGG
GRTRREAPRELRLEVVARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGAVAASLGV
VVVLALAALVLGLVRARSRKAEAAPGPMSQTAPIASSSLQKLGREPPSPPPSEHLYHQTL
PSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSLAARGPDS
GIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFLGGCGLSP
APAGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVFTEIARLK
DEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPASTAVARAIFPPASHRSPISHEGSLSS
AAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSTESGLEPPDDTELRI
NT seq 9876 nt   +upstreamnt  +downstreamnt
atgcagaaggagctgagtgttgcactttcctgtcctggcatgaagagcctcaggactctg
ttaccattgctggtgctgttgggggctacagtgccaggaagctggggtcaggctgggagc
ctggacctacagatcgacgaggaacaaccagcaggcacgctgattggagacatcagtgca
gggcttccaccaggcacagcgccccctcccatgtacttcatctctgcccaggagggcagt
ggcgtaggcacagacctcgctattgacgagcacagtggggtggtccgtacagctcgggtc
ctagaccgtgagcggagagacctttaccgcttcactgcagtcactcctgatggggccacc
gtggaagttacagtgagagtagctgatatcaatgaccatgcaccagctttccctcaggct
cgggaaaccctgcaaatacctgagcatacagctcttggtacacgctacccactggagcct
gctcgtgatgcagacgccggccgcctaggaacccaagggtatgcactatctggtgatggg
gctggagagacctttcggctggagacacgtcctggtcctggtggagctccagtgcctgag
ctggtgattgctggggaactggaccgggagaaccgctcacactacatgttgcagcttgag
gcctatgatggtggctcacccccgcggagagcacaggccctgctagatgtgacacttctg
gatatcaatgaccatgccccagctttcaatcaaagccgataccatgctgtggtatctgag
agtctggcccctggaagtcctgttttgcaggtgtttgcatctgatgctgatgctggtgcc
aatggggctgtgacttatgagatcaacaggagacagagtgaaggtgatggacccttctcc
attgatgcacacacagggtttctgaggctggagcgcccactggactttgaacaaaggcga
gttcatgaactggtggtacaggcacgggatggtggggatcacccagagctgggttcagct
tttgtgacagtgcatgtgcgagatgccaatgacaatcagccgtccatgactgtcatcttc
ctgagtgctgatggctccccccgagtgtctgaggctgccccacctggacagcttgttgct
cgaatctctgtgtcagatccagatgatggtgacttcgcccacgtcaatgtgtccttggag
ggtggagagggccactttgctctgagcacccaagacagtgtcatctatctggtgtgtgtg
gctcgaaggctagatcgggaggagagagatgtctataacttgcgagtcacagccacagac
tcaggctcacccccacttcgggccgaagctgcttttgtgctacatgtcactgatgtcaat
gacaatgcacctgcttttgaccgccagctctaccgacctgagcctctgcctgaagttgca
ttgcctggcagcttcgtggtacgggtgactgcccgggatcctgaccaaggcaccaatggt
caggtcacctacagtctggctcctggcactcacactcactggttctccattgatcccacc
tcaggcatcatcaccacagctgccacactggactatgaactagagcctcagccacagctt
attgtggtggccacagatgggggcctgcctcctttagtctcctcggccacagttagtgtg
gccttacaagacgtgaatgacaatgagccccagttccagaggactttctacaatgcctcg
cttcctgaaggtacccagcccggaacctgtttcctgcaggtaacagccacagatgctgac
agtggcccatttggcctcctctcctattccttgggtgctgggcttggagcttctggatct
cccccattccgcatcgatgcccacagtggtgatgtgtgtaccacccggaccttggaccat
gaccagggaccttcaagctttgacttcacggtgacagctatcgatgggggaggcctcaag
tccatggtgtatgtgaaggtatttgtggcagacgagaatgacaacccacctcagttttat
ccacgggagtatgccgtcagtctgagtgctcagagtacaccaggcacagccgtgctgagg
gtgcatgcccatgaccctgaccagggaccccatgggcgactttcctaccacatcctggct
ggcaacagtcccccactctttgcattggatgcacactcagggctcttgacagtagcctgg
cccttaggcagacgggctaattctgtggtgcagctggagatcggggctcaggatggaggt
ggtctacaagcagaacccattgcccgagtcaacatcagcattgtgcctgggacccccaca
ccacctatatttgagcaactacagtatgttttttcagtgccggaagatgtggcacccggc
accagtgtgggcatagtccaggcacacaacccaccaggtcgcttagggcctgtgaccctc
accctatcaggtggggacccccgagggctcttctccctagattcaccctcagggatacta
aaaacacttcgccctctggaccgggagctcctgggacctgtcctagagctagaagttcga
gcaggcagtggaatcccaccagtgtttgctgtggctcggatccgtgtgctgctggatgat
gtgaatgataattcccctgccttccctgcacctgaagacactgtactgttgccacaaaac
actgctccagggactcccgtctatacactgcgcgctctagaccctgactcgggagctaac
agtagagtcacctttagtctacttgctgggggtgatggactgtttactgtggatcctacc
acaggccacatccagctcatgggacctctggggcctccagggggaccagcccatgagctg
gaggtggaggcccgagatggaggctccccaccacgcaccagccacttccgacttcgtgtg
gtgatacaggatttgggaatccatgggctggctccacgatttgatagccctacctaccgt
gtggacttaccctcgggcactaccaccggaactcagatcttgcaagtgcaagcccaggca
ccagatgggagccctgtcacttaccaccttgcagcagatggagccaataacccctttggc
ctggagtcacagagtgggtggctatgggtacggacagcactagaccgtgagtcccaggag
ttatacacattgaaggtgatggctgtatctggttccaaagctgaattggggcaacagaca
ggcacagccacagtgagggtcattatcctcaaccaaaatgaccacagtccccgcttgtct
gaagagcccacctttctggctgtagcagagaatcaacccccagggaccagtgtaggccga
gtctttgccactgacagagactcaggtcctaatgggcgtctgacctacagccttcaacag
ctttcagaagacaccaaggccttccgcatccacccccagactggagaagtgactacactc
caaaccctggaccgagagcagcagagcagcttccagctcctggtgcaagtgcaggatggg
ggtagtccacctcgcagtgccacaggcactgtgcatgtcgcggtgctcgacctcaatgac
aacagtcccactttcctgcaggcttcaggggctgctggtgggggcctccctatacaggta
ccagaccgagtgcctccaggaacactggtgacaactctacaggccaaggatccagatgag
ggggagaacgggaccatcctatacaccctaactggtcctggctctgagctcttctctctg
catcctcacaccggggagctgcacacagcagcatccctggttagagctgagcggcctcac
tatgtactaactctaagtgctcacgaccagggcagcccccctcgaagtgccagcctccaa
ctgctcgtgcaggtacttccctcaactcgtatggtggagtcaccagatcttatagaagct
gactcagcggcaacagtgcctgtagtacttacagtgacagcagctgaggggcttcgacct
ggatccctgttgggttcggtggccccgcaggagccagctagtgtgggtgtactcacctat
actctggttggtggcgcggaccccgagggtaccttcgcgctggactcaacctctggtcgc
ttgtacttggcgcgccccttggacttcgaggctgggccagcctggcgcgcgctcacggtg
cgcgccgaggggccgggaggcgcaggcgcgcggctgttgagagtgcaggtgcgtgtgcag
gacgagaacgagcacgcgccaacttttgcgcgcgaccccctggccctggcgctacctgag
aaccccgacccgggtgccacgctatacactttccgcgcatcagacttggatggcccaggt
cccaacagtgaggtgcgataccgcctgctgaggcaggagcccccggtgcccgccctgcgc
ttggacgcgcgcaccggggcgctcagcgctcctcgtggtcttgatcgggagaccacaccg
gcgctgttactactcgtggaagccaccgaccggccagccaatgccagccgccgcagggca
gcgcgcgtttcggcgcgcgtctttgtcacggatgaaaatgacaacgcccctgttttcgcc
tccccatcacgggtgcgcctcccagaggatcagccccctgggcccgcagcactgcacgtg
gtagctcgggatccagacctgggggaggctgcccgcgtgtcctatcgccttgccgctgga
ggggatggccacttccggctgcatgcgaccactggagcgctgtctgtggtgcggcctttg
gaccgtgaacagcgagctgagcatgtactgacagtggtggccttggaccatggctccccg
ccgcgttcatctactcagctcctgactgtcagtgttgttgacgtcaacgacgaggcaccg
gttttccctcagcaggagtacaatgtcatccttcgtgagaacagtccacctggcactttt
ctgctcactctgaaggcaactgaccctgaccttggggccaatgggcaagtgacttatggg
ggtgtctctggcgagagcttctctctggacccaaacactggagttctcacgactctgagg
gctctggaccgggaggagcaggaggagatcaatttgacagtatatgcccgggacaggggc
ttgccacccctgttaacgcacatcacagtgagagtgactgtggaagatgaaaatgaccat
actccaacttttgggaacacccacctctccctggaagtgcctgaaggccaggacccccaa
accctaaccacactaagagcctctgatccagatgggggactcaatggacagctacagtac
cgcatccttgatggggacccttcaggagcctttgcactagatctcacttctggggagttt
ggcaccatgaggccactagaccgggaggtagagccagcattccagctgcagatagaggcc
agagatggaggccagccagccctcagtgccaccttacttgtgacagtgacagtgctggat
gccaatgatcatgcaccagtctttcctgtgccttcttattctgtggaggtgcctgaggat
gcacctgtagggaccctactgctgcagctacaggctcatgacccagatgatggggacaat
ggccgtgtaatgtactacctgggtgcaggtacagcgggggccttcctgctggagcctacc
tctggggaactgagcacagctacagccttggacagagaacactgtgccagctatgccttt
tctgtgactgcagtggatggtgcagctgctgggcctatgagcaccacagtaccaatcacc
atcatagtacgtgatgtcaatgatcatgcacccgctttccccacgagtcctctccgcctc
cgcctaccccgcccaggtcctagcctcaacaaaccaaccctggctctggccacgcttcga
gctgaagatcgagatgctggtgccaatgcctccattctataccggctggcgggcacacca
ccacctggcaccactgtggactcttacactggtgaaatacgtgtggctcgatcccccgtg
gctcttggaccccgggatcgcgtcctcttcgttgtagctactgaccttggacgcccagct
cgctccgccactggcgtggtcgttgttggaatacagggagagcctgagcgtggaccccgc
tttcccagagctagtaatgaggctgtgctccgtgaaaatgcaccaccagggactccagtt
atctccccaaaagctgtccattcaggaggctcaaatggaccaattacttacagcattctc
agtgggaatgagagagggatattctccatccagcctagcacaggaaccatcacagttcgc
tcagcagagggtctggactttgaaacaagcccacggctgcggctggtgctgcaggcggag
agtggaggagcctttgctttctcagtgctgaccctgacccttcaagatgccaatgacaac
gctccccgtttcctgcggcctcactacgtggctttcctgccagagtcccgacccttggag
ggggccctgctgcaggtggaggcagatgacctggatcaaggctctggaggacagatctcc
tacagtctggctgcatcccagccagcacggggtttgttccatgtagacccagccacaggc
actatcactaccacagccatcctggaccgggaaatctgggcagaaacacggctggtactg
atggccacagacagaggaagtccagcactggtgggctcagctaccctgacagtgatggtc
atcgataccaatgacaatcgccccaccatcccccagccctgggagctccgagtgtcagaa
gatgcactgttgggctcagagatcgcacaggtgactgggaatgatgtggactctggacct
gtgctatggtatgtgctgagcccatcagggcctcaggatcccttcagtattggccggtat
ggaggacgtgtctccctcacgggccccctggacttcgaacagtgtgaccactaccaccta
cagctgctggcgcatgatgggcctcatgagggccatgccaacctcacagtgcttgtagaa
gatgtcaatgacaatgtacctaccttctcacaaagcctctaccaggtaatgatgttggag
cacacccctccgggcagtgccattctctccgtctctgccactgacagagactcgggtgcc
aatggtcacatatcttaccatctggcttcccctactgagggcttccgtgttgaccctaac
aatggaactctgttcacaacagtaggagcaatggccttgggtcatgaggggccaggagtg
gtggatgtggtgctggaagcccgagacaatggggctccaggccggacggcacaggccacg
gtgcatgtgcaactgaaggaccagaatgaccatgccccaagcttcacattgccacactac
cgtgttgctgtgtctgaagatttgccccctggttccaccctgctcaccctggaggccaca
gatgctgatggaagccgcacccatgctactgtagactacagcatcatcagtggcaatcgg
ggccgagttttccagctggaaccccgtctggctgaggtcggggacagtgttgggccaggt
ccccaagcattgggctgcctagtgttgcttgagcctctagactttgaaagcctgacacag
tataatttaactgtggctgcagctgatcggggacagccaccccgcagttcagctgtgcca
gtgactgtcactgtgctggatgtcaatgacaacccacctgtctttacccgagcatcctac
cgtgtgacaatacctgaagacatgcctgttggagctgagctattgcatgtggaggcctct
gatgctgaccctggacctcatggccttgtgcatttcacccttagctcaggtgaccctttg
ggcctcttcgagctggatgagaactcgggtgccttgaggctggcccaccctctggactgt
gaaacccaggctcgacaccagcttgtggtgcaggcagctgaccctgctggaacacacttt
gctttggtaccagtgacagttgaggtccaggatgtgaatgaccatggcccagccttccca
ttgagcttgctcagtactagccttgctgagaatcagcctccaggcactcttgtgaccaca
ctacacgcaattgatggggatgctgggacttttggtagactccgatatagccttttggag
gcagtgccagggcctgagggtcgtgaggcattttcactgaacagctcaacaggggaattg
cgggcacgggtgccttttgactatgagcacacaggaagcttccgtctactagtgggtgct
gccgatgctggaaatctctcagcctctgtcaccgtgtcagtgctgattactggagaagat
gaatatgaccctgtattcttggctccgtctttccatttccaagtgccagaaggtgcccag
cgaggccacagcctgggtcatgtgcaggccacagatgaggatggaggtgccgatggtctg
gtgctctactcgctggctacctcttccccctattttggtatcaaccagacaacaggtgct
ttatacttgcgagtggacagtcgcgcaccaggaagtggaacaaccacctctgggggtggg
ggtcggacccgacgtgaagcacctcgggagttaaggctggaggtagtagcaagagggcct
ctgcctggatcgcggagtgccacagtgcctgtgactgtggatattacccacactgctcta
ggcctggcacctgacctcaacttgctattggttggggctgtggccgcctccttgggagtt
gtggtggtgcttgccctggcagctctggtcctgggccttgttcgggcacgaagccgcaag
gctgaggcagcccctggcccgatgtcacagacagcacccatagccagtagctctttacag
aaactgggtagggaaccccccagtccaccaccctctgaacatctgtatcatcagactctc
cctagctatggtgggccaggagctggaggtccctaccctcgcggcggctccctggaccct
tcacattcaagtggccgaggctcagcagaggctgcagaggatgacgagatccgcatgatc
aacgagtttccccgagtggccagtgtagcctcctccctggctgcccgaggccctgactct
ggcatccagcaggatgcggatggattgagtgacacgtcttgtgaacctcctgcccctgac
acctggtacaagggcagaaaggcagggttgctgctgccaggtgcaggagccactctgtac
cgagaggaggggcctccagccactgctacagccttcctagggggttgtggcctaagccct
gcacccgctggggactatggcttcccagcagacgggaagccgtgtgtagctggagcacta
acggccatcgtggctggtgaagaagagctccgtggcagctataactgggactacctgttg
agctggtgccctcagttccagcctctggccagtgtcttcacagagattgctcggctcaag
gatgaagctcgtccgtgtcctcccgctccccgtattgacccaccacccctcatcactgct
gtggcacacccaggagccaagtctgttcccccaaagcctgcaagcacagctgtagcccgg
gccatcttcccaccagcctctcaccgctcccctatcagccatgaaggctccctctcctca
gctgccatgtcccccagcttctcaccctcactgtctcctttggctgctcgctctcccgtt
gtctcaccattcggggtagcccagggcccctcagcttcagcactcagcacagagtctggc
ctggagcctccggatgacacagagctgcgcatctag

DBGET integrated database retrieval system