KEGG   Mus pahari (shrew mouse): 110321270Help
Entry
110321270         CDS       T05929                                 

Gene name
Irs1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04022  cGMP-PKG signaling pathway
mpah04068  FoxO signaling pathway
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04722  Neurotrophin signaling pathway
mpah04910  Insulin signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04923  Regulation of lipolysis in adipocytes
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04932  Non-alcoholic fatty liver disease (NAFLD)
mpah04935  Growth hormone synthesis, secretion and action
mpah04960  Aldosterone-regulated sodium reabsorption
mpah05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110321270 (Irs1)
   04022 cGMP-PKG signaling pathway
    110321270 (Irs1)
   04151 PI3K-Akt signaling pathway
    110321270 (Irs1)
   04152 AMPK signaling pathway
    110321270 (Irs1)
   04150 mTOR signaling pathway
    110321270 (Irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110321270 (Irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110321270 (Irs1)
   04923 Regulation of lipolysis in adipocytes
    110321270 (Irs1)
   04920 Adipocytokine signaling pathway
    110321270 (Irs1)
   04935 Growth hormone synthesis, secretion and action
    110321270 (Irs1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110321270 (Irs1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110321270 (Irs1)
  09149 Aging
   04211 Longevity regulating pathway
    110321270 (Irs1)
   04213 Longevity regulating pathway - multiple species
    110321270 (Irs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110321270 (Irs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110321270 (Irs1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    110321270 (Irs1)
   04931 Insulin resistance
    110321270 (Irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 110321270
NCBI-ProteinID: XP_021053120
Ensembl: MGP_PahariEiJ_G0027562
LinkDB All DBs
Position
5
AA seq 1229 aa AA seqDB search
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYIL
SRGGNGHRYIPGANLGTSPALTGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
ASIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSSSSSGISAAPSGSSYGKPWTNGVGGHHTHTLPHAKPPVESSGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSLTHPHHHVLQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSLHPPEPKSPGEYVNIEFGSGQ
PGYLAGPATSRSSPSVRCPPQLHPTPREETGSEEYMNMDLGPGRRATWQENGGVELGRVG
PAPPGSASVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEVSLP
RTTGAAPPPSSTASASVTPQGATAEQATHSSLLGGPQGPGGMSAFTRVSLSPNHNQSAKV
IRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGGSGGGGGGSEDVKRHSSASFENVW
LRPGDLGGVSKESAPVWGAAGGLEKSLNYIDLDLAKERSRDCPSQQQSLPPPPPHQPLGS
NEGNSPRRSSEDLSNYASISFQKQPEDHQ
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcagacgtgcgcaaggtgggctacctgcgc
aaacccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccggcgcgcctggagtattatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgcggcggatagcgaa
gctgagcaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggtggtagctgcagcggcagctctggcgtcggagag
gcaggggaggacttgagctatgacacgggtccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcctgggtcagacaaagaacctgattggcatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctgaactccgaggcagccgctgtggtg
ttgcagctgatgaacatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcgttcagctgtgacagggcctggcgagttctggatgcaagtggatgactccgtggtg
gctcagaacatgcatgagaccattctagaggccatgcgggccatgagcgatgagtttcgc
ccgcgcagcaaaagccagtcttcatccagttgctccaaccccatcagcgttcccctgcgc
aggcaccatctcaacaaccctccacccagccaggtgggactgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttccgg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggctg
caccccccactcaaccacagccgctccatccccatgccttcttcacgatgctcaccttca
gccaccagcccagtgagtctgtcatccagtagtaccagtggccatggctccacttcagac
tgtctcttcccgaggcgctctagtgcttcagtgtctggttctcctagcgatggcggtttc
atctcttctgatgagtatggttctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctggggcacaccccaccagccaggggtgaggaggagctgagcaattat
atctgcatgggtggcaagggagcctccaccttggctgctcccaatggtcactacattttg
tctaggggtggcaacggccatcgctacatcccaggtgctaacttggggacaagcccagcg
ctgactggagatgaagccgcgggtgcagcagatctggataaccggtttcggaagagaact
cactccgcaggcacatcgcctaccatttcccatcagaagaccccctcacagtcttcagtg
gcttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattcagccttcgtgcccacccactcctatcccgaa
gagggtctagagatgcaccacttggaacgtcgtggaggccaccaccgtccagacacctcc
aacctccacactgatgatggctacatgcccatgtctcctggggtggctccagtgcccagc
aaccgcaaaggaaatggagactatatgcccatgagccccaagagtgtatctgccccacag
cagatcattaaccccatcagacgccacccacagagagtggaccccaatggctatatgatg
atgtcacccagtggtagttgctcacctgacattggaggtgggtccagcagcagtagtggc
atcagcgcagccccttctgggagcagctatgggaagccatggacaaatggagtagggggg
caccatactcataccctgcctcatgccaaaccccctgttgagagcagtggtggtaagctc
ttgccttgcacaggtgactacatgaacatgtcaccagtgggagattccaacaccagcagc
ccctcagaatgctattatggcccagaagatccccagcacaagccggtcctctcttactac
tcattgccaaggtcctttaagcacacccagcgccctggagagccagaggagggtgccagg
caccagcatcttcgtctctcttcgagctctggacgccttcgctataccgcaactgccgaa
gattcctcctcttctaccagcagcgacagtctgggtgggggttactgtggggccaggcca
gagtctagcctcacacatccccaccaccacgtcttgcagccccatctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcaccttaccccgggttcgagagcagcaacagcagcagcagtcttccctg
caccctcccgagcccaaaagcccaggagaatatgtgaatattgaattcgggagcggccag
cctggctatttagcgggccctgcaacttcccgtagctctccttcagttcgatgtccaccc
cagctccacccaactcctagagaagagactggctcggaagagtacatgaacatggacttg
gggccaggccggagggcaacctggcaggagaatggtggagttgagttgggcagagtaggc
cctgcacctccggggtctgctagcgtttgcaggccaacccgatcggtgccaaatagccgt
ggtgactacatgaccatgcagataggttgtcctcgtcaaagctatgtggatacctcacca
gtggccccagtcagctatgctgacatgcggacaggcattgctgcagaggtgagcctgcct
agaaccacaggagctgctcctcctccatcctccacagcctctgcttctgttacacctcaa
ggagccaccgctgagcaagctactcactcttccttgctgggaggccctcagggacctggg
ggcatgagtgcattcaccagggtgagcctcagtcccaaccataaccagagtgccaaagtg
attcgcgcagacacgcaagggtgccggaggaggcatagctctgagaccttctcagcacct
actcgggctggcaatacagtgccctttggagcaggggctgcagtagggggcagcggtggt
ggaggtggcggcagtgaggatgtaaaacgccacagctctgcatcctttgagaatgtgtgg
ctgagacctggggatctagggggagtctccaaggagtcggctccagtgtggggggctgct
gggggtctggagaagagtcttaactacatagacctggatttggccaaggagcgctctcgg
gactgcccctctcaacagcagtccttaccacccccaccccctcaccagcccttaggcagc
aatgagggcaactccccaagacgctccagtgaggatttaagcaactatgccagcatcagc
ttccagaagcagccagaagatcatcaatag

DBGET integrated database retrieval system