KEGG   Mus pahari (shrew mouse): 110321275
Entry
110321275         CDS       T05929                                 

Definition
(RefSeq) aldehyde oxidase 3 isoform X1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00280  Valine, leucine and isoleucine degradation
mpah00350  Tyrosine metabolism
mpah00380  Tryptophan metabolism
mpah00750  Vitamin B6 metabolism
mpah00760  Nicotinate and nicotinamide metabolism
mpah00830  Retinol metabolism
mpah00982  Drug metabolism - cytochrome P450
mpah01100  Metabolic pathways
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110321275
   00350 Tyrosine metabolism
    110321275
   00380 Tryptophan metabolism
    110321275
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    110321275
   00760 Nicotinate and nicotinamide metabolism
    110321275
   00830 Retinol metabolism
    110321275
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    110321275
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110321275
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     110321275
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Other DBs
NCBI-GeneID: 110321275
NCBI-ProteinID: XP_021053126
Ensembl: MGP_PahariEiJ_G0027398
LinkDB
Position
5
AA seq 1335 aa
MSPSKESDELIFFVNGKKVTERNADPEVNLLFYLRKVIRLTGTKYGCGGGDCGACTVMIS
RYDPISKSISHFSAAACLVSICSLHGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFC
TPGMVMSIYALLRNHPEPSTEQIMEALGGNLCRCTGYRPIVESAKSFSPSSACCQMNGKG
KCCLDEEKDEPERKNSVCTKLYEQKEFQPLDPSQELIFPPELMRMAEESQNTVMTFHGER
TTWIAPGTLNDLLELKMKYPSAPLVTGNTYLGLNMKFTDVSYPIIISPARILELFVVTNT
KQGLTLGAGLSLTQVKNILSDVVSRLPREKTQIYCALLKHLKTLAGQQIRNAASLGGHII
SRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPEASLKPEQVLISVFVPRSR
KWEFVSAFRQAPRQQNAFAIVNAGMRVIFKEDTNTITDLSILYGGIGATVVSADKSCRQL
IGRCWDEEMLHDAGKMVCEEVSLLMAAPGGMEEYRKTLAISFLFMFYIDVLKQLKIRDPH
RYPDISQKLLHVLEDFPLTMPYGMQSFQDVDFQQPPQDPVGRPIMHQSGVKHATGEAVFC
DDMAVLPGELFLAVVTSSKSHAKIVSIDASEALASLGVVDVITARDVPGDNGREEESLYA
QDEVICVGQIVCAVAADTYAHAQQATKKVKIVYQDVEPMIVTVQDALKYESFIGPEKRLE
QGNVEEAFQCADQILEGDVHLGGQEHFYMETQSVRVVPKGEDKEMDIYVSSQDAAFTQEM
VARTLGIPKNRINCHVKRVGGAFGGKASKPGLLAAMAAVAAQKTGRPIRFILERRDDMLI
TGGRHPLLGKYKIGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYKIPNLR
VRGRVCKTNLPSNTAFRGFGFPQGAFVTETCVSAVAAKCGLPPEKVRELNMYRTIDRTIH
NQVFDPTNLLQCWEACIENSSYYNRKKAVDEFNQQRFWKKRGIAIIPMKFSVGFPKTFYY
QAAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELRIPMSYIHLDEMSTVTVPNTV
TTGASTGADVNGRAVQNACQILMKRLEPIISKNPSGTWEEWVNEAFIQSISLSATGYFRG
YQADMDWEKGEGDIYPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQI
EGAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVTDIPEEFHVSLLTPTPNPKAIYS
SKGLGEAGTFLGCSVFFAIAAAVAAAREERGLSPIWAINSPATAEVIRMACEDQFTNLVP
QTDSKCCKPWSIPVA
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgtctccttctaaggagtcagatgagcttattttctttgtgaatggaaaaaaggtcacc
gagaggaatgcagaccctgaggttaatttattgttctacttgagaaaagtcatccgactc
acagggacaaagtatggctgtggaggaggtgactgtggcgcctgcacagtgatgatctca
agatacgaccccatctccaaaagtatcagtcatttctctgctgctgcctgcctggtctcc
atctgctctctccatggggctgctgtcactacagtagaaggcataggaagcaccaaaacc
aggatacaccctgtccaggaaaggattgccaaaggccatggtacccagtgcgggttctgc
actcccgggatggtgatgagcatctatgctctcctgaggaaccacccagagccctccaca
gaacagataatggaagccctgggcgggaatctatgccgctgcactggatacaggcccatt
gtggagagtgcgaaaagtttcagccctagttcagcttgctgccagatgaatgggaaaggg
aaatgttgcttggatgaagaaaaagacgagcctgagagaaaaaacagtgtttgcaccaag
ttgtatgaacaaaaagaatttcagcccttggatccatctcaggagcttatatttccacct
gaactgatgcggatggccgaggagtcccaaaatacagtgatgacttttcatggggaaagg
acaacctggattgccccaggaaccctaaatgaccttctggaactgaaaatgaagtacccc
agcgctccccttgtgactggcaacacctatctcgggcttaatatgaagttcacagacgtt
tcttatccgattatcatctctcctgcaaggatcttagaattatttgtggtgactaataca
aagcaagggctgacactgggcgcaggcctcagcctgacccaggtgaagaacatcctgtct
gatgtggtctccaggctccccagggagaagacgcagatatactgtgccctcctgaagcat
ttgaagaccttggctgggcagcagatcaggaatgcggcctccttaggtggtcatattatc
agtagactgccgacctctgacctcaaccctattttgggcataggcaattgcatcctcaat
gttgcttcaacagaaggaatacagcaaatccctctgaatgaccattttctcgctggagtt
ccagaggcaagcctgaagccagagcaagtgctcatctctgtttttgtgccacgctccagg
aagtgggagtttgtatcagctttcagacaggcccctcgccagcaaaatgcgtttgcaata
gtgaatgctggaatgagggtcattttcaaagaggacacgaacaccattacagacttgagc
atcttatatggagggattggtgccaccgtagtcagcgcagataagtcctgccggcagctg
attggaaggtgctgggatgaagagatgctgcatgatgctggcaagatggtgtgtgaggaa
gtctccctcctgatggcagcccctggaggaatggaggaataccggaagactcttgccatc
agtttcctcttcatgttttacatagacgtgttgaagcagttaaagataagggacccccac
agataccctgacatctcgcagaaactcctacacgttctggaagacttccctttaaccatg
ccttatgggatgcagtcatttcaggacgtagacttccaacagcctccgcaagacccagtc
gggcgtcctatcatgcatcagtctggcgttaaacacgccacgggggaggcggtcttttgt
gatgatatggctgtgttgcctggggaactcttcctggcagtggtaaccagcagcaagtca
catgctaaaattgtctccattgatgcctccgaggccttggcatcacttggtgtggttgat
gtgataacagctcgagatgtgcctggtgacaatggcagagaagaagaaagcctatatgca
caggatgaggtgatctgcgtgggtcagattgtgtgtgctgtggccgctgatacttatgcg
catgcccagcaggccacaaaaaaagtgaagattgtctatcaagacgtggagcccatgatt
gtgacagtgcaggatgcactgaaatatgaatcattcatcggacctgaaaaaagactagaa
caaggaaatgttgaggaagcatttcaatgtgccgatcaaatcctcgaaggggacgtgcac
ttgggaggccaggagcacttttacatggagactcaaagcgtgcgtgtggtccccaaggga
gaggataaggagatggacatctatgtgtcaagccaggatgcagcatttacacaggaaatg
gtggctcgaaccttgggcatcccaaagaataggatcaactgccatgtgaaaagggttggt
ggagccttcggagggaaagcgagcaagcctgggctcctggcagccatggcagctgtagcc
gcacagaaaactggccgcccaatacgttttattctagagcgtagggatgacatgttgata
actggaggacgtcacccactcctcgggaaatacaagattggcttcatgaacaatgggaaa
atcaaggcggcagacatccagctttatatcaatggaggctgcaccccagacgattctgaa
ctggtgatagaatatgctctgctcaaactggaaaatgcttacaagatccccaacctccgt
gtccgtggtcgagtctgtaagaccaacttgccatccaatacagcattccgaggatttggc
ttcccccagggggcgtttgtaacagaaacctgtgtgtctgctgtggcagccaagtgtggt
ttaccaccagagaaggttcgagaattaaacatgtacagaacaatcgataggacaattcac
aaccaagtatttgacccaacaaatctgctacagtgctgggaggcgtgtatagaaaattct
tcctactataacaggaaaaaagctgtggatgaatttaaccaacagaggttttggaagaag
agaggaattgccatcatccccatgaaattctcagttggatttccaaagacattttattat
caggctgccgctttggtccagatctacacagatgggtctgtactagttgctcatggtggt
gttgaactgggacaaggtattaacaccaaaatgatacaggtagccagccgtgaattaagg
ataccaatgtcttatatacatctggatgagatgagcactgtgaccgtccccaacacggtt
accactggagcatccaccggtgccgatgtcaacgggagagctgttcagaatgcctgtcag
atcctcatgaagcgtctggaacccatcatcagcaagaatcctagtggaacctgggaagag
tgggttaatgaagctttcattcaaagcattagcctctcggccactggatattttaggggt
taccaagctgacatggactgggagaagggagaaggtgacatttacccctattttgttttt
ggagctgcctgttctgaggttgaaattgactgtctgacgggagctcacaagaacattaga
actgacattgttatggatggatctttcagtataaaccctgctgtggacataggccagatt
gaaggggcatttgttcaaggtcttggactgtatactctagaggaactgaaatattcacct
gaaggagtcctatacacgcgcggtccacaccagtacaaaatagcatcggttactgacatc
ccagaagaattccatgtatcactgttgacaccaaccccaaacccaaaagccatctactct
tctaagggccttggcgaagctggaacgtttctgggctgttctgtgttcttcgctattgct
gctgctgtggctgcagctcgtgaggaaagaggcttgtccccgatttgggccataaacagt
cctgccacagcggaagtgatccgtatggcctgtgaggaccagttcacgaacctggttcca
caaacggattctaaatgctgtaagccgtggtccatcccagttgcctag

KEGG   Mus pahari (shrew mouse): 110321290
Entry
110321290         CDS       T05929                                 

Gene name
Aox1
Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00280  Valine, leucine and isoleucine degradation
mpah00350  Tyrosine metabolism
mpah00380  Tryptophan metabolism
mpah00750  Vitamin B6 metabolism
mpah00760  Nicotinate and nicotinamide metabolism
mpah00830  Retinol metabolism
mpah00982  Drug metabolism - cytochrome P450
mpah01100  Metabolic pathways
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110321290 (Aox1)
   00350 Tyrosine metabolism
    110321290 (Aox1)
   00380 Tryptophan metabolism
    110321290 (Aox1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    110321290 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    110321290 (Aox1)
   00830 Retinol metabolism
    110321290 (Aox1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    110321290 (Aox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110321290 (Aox1)
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     110321290 (Aox1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 110321290
NCBI-ProteinID: XP_021053166
Ensembl: MGP_PahariEiJ_G0027397
LinkDB
Position
5
AA seq 1333 aa
MEALQLLFYVNGQKVVEKNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNP
STKVIRHHPVNACLTPICSLHGTAVTTVEGLGNTRTRLHPIQERIAKCHGTQCGFCTPGV
VMSMYALLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKASGCCQSKENGVCCL
DQGINGLAEFQEEDKTSPELFSEEEFLPLDPTQELIFPPELMRLAEKQPPKTRVFYGERV
TWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELGVISQAW
DGLTLGAGLSLDQVKDILADVVQKLPEEKTQTYRALLKHLRTLAGSQIRNMASLGGHVVS
RHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKCPEADLKPQEVLVSVNIPWSRK
WEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGIIEELSILYGGVGSTTVSAKNSCQRLI
GRPWNEEMLDTACRLVLDEVTLAGSAPGGKVEFKRTLIISFLFKFYLEVSQSLKREDPGH
SPSLVGNNESALDDLHSRHHWRTLTHQNVDPVQLPQDPIGRPIMHLSGIKHATGEAIYCD
DMPAVDQELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITADHLQEANTFGTETFLAT
DEVHCVGHLVCAVIADSETRAKQAAKRVKVVYRDLEPLILTIEEATQHKSFFESERKLEC
GNVDEAFKIVDQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKYIQDIV
AATLKLSVNKVMCHVKRVGGAFGGKVGKTSILAAITAFAASKHGRAVRCVLERGEDMLIT
GGRHPYLGKYKAGFMNDGRILALDVEHYCNGGCSLDETLWVIEMGLLKMDNAYKFPNLRC
RGWACRTNLPSNTALRGFGFPQAGLVTEACITEVAIKCGLSPEQVRSINMYNHIDNTHYK
QEFSAKGLSECWRECMAKCSYSERKAAVGKFNAENSWKKRGMAVIPLKYPVGFGSVAMGQ
AAALVHIYLDGSALVSHGGIEMGQGVHTKMIQVVSRELRMPMSSVHLRGTSTEIVPNTNA
SGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKEWAQTAFDQSISLSAVGYFRGY
ESNIDWEKGEGHPFQYFVFGAACSEVEIDCLTGDHKNIRTDIVMDVGHSINPALDIGQVE
GAFIQGMGLYTIEELSYSPQGTLYSRGPNQYKIPAICDIPTEMHISFLPPSELSDTLYSS
KGLGESGVFLGCSVFFAIHDAVRAARQERSISGPWKLSSPLTPEKIRMACEDKFTKMIPR
DEPGSYVPWNIPV
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggaagccctacagctgctcttctacgtgaatggccagaaggtggtagaaaaaaatgtc
gatcctgaaatgatgcttttaccatacctgaggaagaatctccgactcacaggaactaag
tacggctgtggaggtgggggctgcggggcctgcacagtgatgatctcacggtacaacccc
agcaccaaggtgatcaggcatcatccagtcaatgcctgtctgacccccatctgctctctg
catggtacagcagtcaccacggtagaaggcttaggcaacaccaggaccaggcttcatcct
attcaggagaggattgccaagtgtcacggcacccagtgtggattctgtactcccggggtg
gtgatgtccatgtacgcactgctcagaaaccatccagagcccactctagatcagttaact
gatgcccttggtggaaatctgtgccgctgcactggatataggcccataatcgatgcttgc
aagactttctgtaaagcctctggctgctgtcaaagtaaagaaaatggggtgtgctgtttg
gatcaaggaataaatggattggcagaattccaggaagaagataagacaagtccagaactg
ttctcagaagaggaatttctgccactggacccaacccaagagctgatattcccaccagag
ctaatgagactagctgagaaacagccaccaaagaccagagtgttttatggtgagagagtg
acatggatttcccctgtgactctgaaggaacttgtggaagcaaaattcaagtatccccag
gcccccattgtcatggggtacacctctgtagggcctgaagtaaagtttaaaggtgtcttc
caccccatcataatttctcctgacagaattgaagagctgggtgtcataagccaggcctgg
gatgggctgaccctgggtgctggcctcagcctggatcaggtgaaggacattctggctgat
gtagtccagaagcttccagaagagaagacgcagacataccgcgctctcctgaagcacctg
agaactctagctggctctcagatcaggaacatggcttctctagggggccacgtcgtgagc
agacatctggactcagatctgaatccccttctggctgtgggtaactgtaccctcaactta
ctatccaaagatggagaacggcggatccctttaagtgaagagttcctccgaaagtgtcct
gaagcagatctaaagcctcaggaagtcttggtctcagtgaacatcccctggtccaggaag
tgggagtttgtgtcagccttccgacaagctcagagacaacagaatgcactagcaatagtc
aactccggaatgagagtcctttttagagaaggaggtggcatcattgaagagttatccatt
ttatatggaggtgtcggttcaaccaccgtcagtgccaagaactcctgtcagagactcatt
ggaaggccctggaatgaagagatgctggacacagcctgtaggctggttttggatgaagtc
acccttgcaggctcagctcctggtgggaaggtagagttcaagaggaccctcatcatcagc
ttccttttcaagttctacctggaggtgtcacagagtttgaagagggaggacccaggtcat
tctcctagcctggtaggcaacaatgagagtgctttagatgatcttcattcaagacatcac
tggagaacattaacccaccagaatgtagacccagtgcagctgcctcaggaccccattgga
cgtcccatcatgcacctttctgggattaagcatgccaccggcgaggccatctactgtgat
gacatgcctgcagtggatcaggagcttttcctcacttttgtaacgagttccagagcacac
gctaagattgtgtccattgatctgtcagaagctctcagcctgcctggcgtggtggacatc
attactgcagatcatcttcaggaagcaaacaccttcggcacagagacatttctggccaca
gatgaggtacactgcgtgggccatcttgtctgtgccgtgattgcagattctgagacacgg
gcaaagcaagcggcgaagcgagtgaaggtcgtctaccgagacttggagcccctgatccta
acgattgaggaagcaacacaacacaagtccttcttcgagtcagaacggaaactggagtgt
gggaatgttgacgaagcatttaaaatcgttgatcaaattcttgaaggtgaaatacacata
ggcggccaggaacatttttatatggaaacccaaagcatgcttgttgttcccaaaggagag
gatggagagattgacatctatgtgtctacacagttccccaaatatatacaggatatagtt
gctgcaaccttgaagctctcagtcaacaaggtcatgtgccatgtaaagcgtgttggcggg
gcatttggagggaaggtgggcaagaccagcattttggcagccatcaccgcatttgctgct
agcaaacatggtcgcgcagtccgctgcgttctggaacgaggagaagacatgttgataact
ggaggccgccatccttaccttggaaagtataaagctggattcatgaacgatggcagaatc
ttggccttggatgtggaacactactgcaatggagggtgctccctggatgagacactatgg
gtgatagaaatgggacttctgaagatggacaatgcttacaagtttcccaacctacgctgc
cggggctgggcctgcagaaccaaccttccatccaacactgctctgcgtgggtttggattt
cctcaggcagggctggtcactgaagcctgtatcacggaagtggcaatcaaatgtggcctg
tcccctgagcaggtccgatccataaatatgtacaaccacattgataatacccactacaag
caagagttcagcgccaagggcctctctgagtgctggagagagtgcatggccaagtgttcc
tactctgagaggaaagcagctgtaggaaaattcaacgcagagaattcctggaagaagagg
ggaatggctgtgattcccctgaagtatcctgtgggttttggatcagtagccatgggacag
gcagctgccttggttcatatttatctggatggctctgcactggtctctcacggtgggatc
gagatggggcagggtgtgcacactaaaatgattcaggtggtgagccgggaactaaggatg
ccaatgtccagtgtccacctgcgtgggacaagcacagaaatcgtccccaacacaaatgcc
tctggaggctctgtggtggcagatctcaacggactggcagtaaaggatgcctgtcagacc
cttctaaaacgccttgaacccatcatcagcaagaatcctcagggaacttggaaggaatgg
gcccagactgcttttgaccagagcatcagtctctcggctgttggatatttcaggggttat
gagtcgaatatagactgggagaaaggagaaggccatcccttccaatacttcgtgtttgga
gctgcctgctcagaggttgaaatagactgcctgactggggaccataagaatatcagaaca
gacatcgtgatggatgttggccacagcataaacccagcccttgacataggccaggttgaa
ggcgcatttattcaaggaatgggactttacacaatagaggagctgagttactctcctcag
ggcactctatacagtcgtggtccaaaccaatacaagattcctgccatctgtgacatcccc
acagagatgcacatttcttttttgcccccatctgaactctcagacaccctgtattcatct
aagggcctgggagagtctggggtgttcctgggatgttcagtattttttgccatccatgat
gcggtgagggcagcgcggcaggagagaagcatctctggaccatggaagctcagtagtcct
ctgactccagagaaaatcagaatggcctgtgaagataagttcacaaaaatgatcccaaga
gatgagcctggatcctatgttccctggaacatacctgtgtga

KEGG   Mus pahari (shrew mouse): 110321921
Entry
110321921         CDS       T05929                                 

Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah00280  Valine, leucine and isoleucine degradation
mpah00350  Tyrosine metabolism
mpah00380  Tryptophan metabolism
mpah00750  Vitamin B6 metabolism
mpah00760  Nicotinate and nicotinamide metabolism
mpah00830  Retinol metabolism
mpah00982  Drug metabolism - cytochrome P450
mpah01100  Metabolic pathways
mpah04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110321921
   00350 Tyrosine metabolism
    110321921
   00380 Tryptophan metabolism
    110321921
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    110321921
   00760 Nicotinate and nicotinamide metabolism
    110321921
   00830 Retinol metabolism
    110321921
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    110321921
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110321921
Enzymes [BR:mpah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     110321921
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 110321921
NCBI-ProteinID: XP_021054180
Ensembl: MGP_PahariEiJ_G0027399
LinkDB
Position
5
AA seq 1317 aa
MPSVSESDELIFFVNGKKVIEKNPDPEENLLFYIRKVLNLTGTKYSCGTGGCGACTVMVS
RYNPETRKIYHYPVTACLVPICWLHGAAVTTVEGVGSIKKRVHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVESGKTFSPMCTKLYNEDEF
QPFDPSQEPIFPPELIRMAEDPNKRKLTFQGKRTTWIIPVTLNDLLELKANYPEAPLVMG
NTAVGPRIKFNDEFYPVFISPLGVPKLNVMDTTNNGVTVGAGYSLAQLKDALNFLISKQP
EEKTKTYHALQKHLRTLAGPQIRNMATLGGHIASRPSFSDLNPILAAGNANINVISKEGK
ELQLPLNGPFLEKLPEADLKPEEVILSIFIPYTAQWQFVSGLRLAQRQENAFAIVNAGMG
VEFEEGTNTIKDLKMFFGSVAPTVVSASQTCKQLVGRQWDDQMLSDACQLVLQEIHIPPD
AEGGMVEYRRTLIISLLFKFYLKVQRWLNEMKVLLAPEKKDPQKFPDIPEKSVSALDDFP
IETPQGIQMFQCVDPKQPQKDPVGHPIMHQSGIKHATGEAIFVDDMPPIDQELCLAVVTS
TRAHAKIISLDVSEALACPGVVDVITAEDVPGENNHSGEILYAQSEVICVGQIICTVAAD
TYIHAKEAAKRVKIAYDDIEPTIITIEQALEHNSFLSDEKKIEQGNVEYAFKHVDQIIEG
EIHVEGQEHFYMETQTILAIPQTEDKEMVLHLGTQFPTHVQEFVSAALNVPRSRIACHMK
RAGGAFGGKVTKPALLGAVCAVAANKTGRPIRFILARSDDMLITAGRHPLLGKYKIGFMN
NGEIKAADVEYYINGGCTPDESELVIEFVVLKSENTYHIPNFRCRGRACKTNLPSNTAFR
GFGFPQATVVVEAYIAAVASKCNLLPEEVREINMYKQTSKTAFKQTFNPEPLRRCWKECL
EKSSFFARKKAAEEFNRNNYWKKRGLAVVPMKFSVAIPTAFYNQAAALIHIFLDGSVLLT
HGGCELGQGLHTKMIQVVSRELNIPKSYVHFSETSTTTVPNALFTSGSMGADIYGKAVQN
ACQILMDRLRPIIRKNPKGKWEEWVKMAFEESISLSATGYFKGYQTNMDWKKEEGDPYPY
YVYGAACSEVEVDCLTGAHKLLRTDIFMDAAFSINPALDIGQVEGAFIQGMGFYTIEELK
YSPKGVLYSRGPEDYKIPTVTEIPEEFYVTLVHSRNPIAIYSSKGLGEAGMFLGSSVLFA
IYDAVTTARKERGLSDIFPLNSPATPEVIRMACTDQFTDMIPRDDPSTFTPWSIHVS
NT seq 3954 nt   +upstreamnt  +downstreamnt
atgccttccgtttccgagtctgacgagctgattttttttgtgaatgggaaaaaggtcata
gagaagaaccctgaccctgaagagaatctactgttctacatcaggaaagttctcaacctc
acaggcaccaagtacagctgtgggacaggaggctgcggggcctgcactgtgatggtgtcg
agatataatccagagaccaggaagatctaccactacccagtaacagcatgcctggtgccc
atctgctggcttcatggagcagccgttaccacagtggaaggtgtgggaagcatcaaaaag
agggtccacccagtgcaggaacggcttgccaagtgtcatggcacccagtgtggcttttgc
agccctgggatggtgatgtccatttacacactgctcaggaaccacccggagccaacacca
gatcagatcacggaggctctcggagggaatttgtgccgatgcactggatatcgaccaatt
gtagaaagcgggaaaacattctctccgatgtgtactaaactgtataatgaagatgagttc
cagccatttgacccatcgcaggaacctatatttcctcctgaactgatcagaatggcagaa
gatccaaacaaaaggaagctgacattccaagggaaaaggaccacctggatcatccctgtg
accttgaatgacctcctggaactgaaagccaactaccctgaagccccacttgtcatgggg
aacactgcagtgggacccaggattaaatttaatgatgaattctatccagtttttatatcc
ccacttggagttcccaaactaaatgttatggacaccacaaacaatggggtaacagtagga
gcaggatacagcctggcacagcttaaagatgccttgaattttctgatatcaaaacaacca
gaggagaagaccaagacctatcacgccctccagaaacatctgaggacacttgcagggccc
cagattaggaatatggctactttaggaggacatattgcgagccgtccttctttttctgat
ctcaaccctattttggcagctggaaatgctaacatcaatgtgatatctaaagaaggaaaa
gaactgcagctccctttaaatggccctttccttgagaagttgcctgaggccgacttgaaa
ccagaagaggttatcttgtccattttcattccttacactgctcagtggcagtttgtgtca
ggactccggttggcacagcgtcaggaaaatgcctttgctattgtcaatgctggaatgggc
gtggagtttgaggaaggcacaaacacgatcaaggatcttaagatgttctttggaagtgtt
gcccccactgtggtctctgcaagtcaaacctgcaagcagctcgttgggaggcaatgggat
gaccaaatgctgagtgatgcatgccaactggtcctgcaggagatccacatcccaccagat
gctgagggaggcatggtggagtaccgacgcaccctcatcatcagcttgcttttcaaattc
tacctgaaagtgcagcgatggctgaatgaaatgaaagttctgttagctcctgagaagaag
gatcctcagaagtttcctgacatcccagaaaagtctgtgagtgccctagatgacttcccc
atagaaacaccccaaggaatccagatgttccagtgtgtggatcccaaacaaccccagaaa
gatccagttgggcacccaatcatgcaccagtcgggtattaaacatgccacaggggaagct
atatttgttgatgacatgcctcccattgaccaagaactctgccttgccgttgtcacgagt
accagggcccatgcaaagatcatatcacttgatgtatcagaagccctggcgtgtccgggt
gtggtggatgtgatcacagctgaggatgtcccgggagaaaataaccacagtggagagatt
ctttatgcgcagagtgaggtcatttgcgtgggtcagatcatctgcacggtggctgcggat
acctacatccatgcaaaagaagcagctaaacgagtgaagattgcttatgatgacatagag
ccaaccattatcacgatcgagcaagccctagaacacaattctttcctttctgatgagaaa
aaaattgaacaaggaaatgtagaatatgccttcaaacatgtggatcaaatcattgaaggt
gagatccacgtggaagggcaggaacatttttacatggaaacgcaaaccatcctggctatc
ccacaaactgaagacaaagaaatggtgttacacttggggacacagtttccaacccacgtg
caggaatttgtgtctgcagcattaaatgtcccaaggagcaggatcgcctgccacatgaaa
agagctggaggagcatttgggggcaaagtgaccaagcctgctctactgggagctgtctgt
gctgtggctgccaacaagactggccgcccaatccgcttcatcctagcacgaagtgatgac
atgctgataacagctggccgccacccactcctgggaaaatacaaaatcgggttcatgaat
aatggagagatcaaggctgctgacgttgaatattacattaatggaggatgcacccctgac
gaatctgagctggtgatagaatttgtcgtgctgaaatctgaaaatacatatcatattcca
aatttccggtgccggggcagggcttgcaaaacaaacttgccatcaaacacggctttccga
ggattcggcttccctcaggctacggtggtcgtcgaagcatacatagctgcagtagcatct
aaatgtaacttactccctgaagaggttagagaaataaacatgtataagcaaactagcaag
acggcctttaagcagacgtttaatccagagcccttgcggagatgctggaaggagtgtctg
gagaagtcgtcgttctttgctaggaagaaggctgcagaggaatttaacagaaacaactat
tggaagaagagggggcttgctgttgtccccatgaagttcagcgttgcgatccccacagcc
ttctacaatcaggccgctgctctgatccacatcttcttagatggctctgtcctgctgacc
cacggtggctgtgagctgggacaaggcctacacaccaagatgattcaggtagtcagcaga
gaactcaacatccccaagtcgtatgtgcacttttctgaaaccagcactaccacagtgccc
aacgctctcttcacttcgggctccatgggagcagacatctatgggaaggctgtacagaat
gcctgccagattcttatggaccgtcttcggcccatcatcaggaaaaaccctaaaggaaaa
tgggaggagtgggttaaaatggcctttgaagaatccatcagtctctcagcaactggatat
ttcaaaggctaccagacaaacatggactggaagaaggaggaaggtgatccttacccgtac
tatgtctatggcgcagcctgctctgaggttgaagtggactgtcttactggggctcacaag
ctcctgcggaccgacatcttcatggatgctgccttcagcattaaccctgccctggatatc
gggcaggttgagggagcctttatccaaggcatgggattctacaccatagaggaattgaaa
tactccccaaaaggtgtgctctattctcggggcccggaagactacaaaatccccactgtc
actgagataccagaggagttctacgtcactctggtgcactctcgaaatcccatagccatc
tattcatccaagggattgggtgaggctggcatgttcctggggtcctcagttttatttgcc
atatatgatgctgtgaccactgcccgcaaggagagagggctgagcgacatcttccccttg
aatagcccagcaacacctgaagtgattcgcatggcatgtacggatcagtttactgacatg
attcccagagatgacccttcaacattcacaccttggtccatccatgtgtcttaa

DBGET integrated database retrieval system