KEGG   Mus pahari (shrew mouse): 110321591
Entry
110321591         CDS       T05929                                 

Gene name
Bcl2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah01524  Platinum drug resistance
mpah04064  NF-kappa B signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04071  Sphingolipid signaling pathway
mpah04115  p53 signaling pathway
mpah04140  Autophagy - animal
mpah04141  Protein processing in endoplasmic reticulum
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04217  Necroptosis
mpah04261  Adrenergic signaling in cardiomyocytes
mpah04340  Hedgehog signaling pathway
mpah04510  Focal adhesion
mpah04621  NOD-like receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04725  Cholinergic synapse
mpah04915  Estrogen signaling pathway
mpah04928  Parathyroid hormone synthesis, secretion and action
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05014  Amyotrophic lateral sclerosis
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05162  Measles
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05215  Prostate cancer
mpah05222  Small cell lung cancer
mpah05226  Gastric cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110321591 (Bcl2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110321591 (Bcl2)
   04630 JAK-STAT signaling pathway
    110321591 (Bcl2)
   04064 NF-kappa B signaling pathway
    110321591 (Bcl2)
   04066 HIF-1 signaling pathway
    110321591 (Bcl2)
   04071 Sphingolipid signaling pathway
    110321591 (Bcl2)
   04151 PI3K-Akt signaling pathway
    110321591 (Bcl2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110321591 (Bcl2)
  09143 Cell growth and death
   04210 Apoptosis
    110321591 (Bcl2)
   04215 Apoptosis - multiple species
    110321591 (Bcl2)
   04217 Necroptosis
    110321591 (Bcl2)
   04115 p53 signaling pathway
    110321591 (Bcl2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110321591 (Bcl2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110321591 (Bcl2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    110321591 (Bcl2)
   04928 Parathyroid hormone synthesis, secretion and action
    110321591 (Bcl2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110321591 (Bcl2)
  09156 Nervous system
   04725 Cholinergic synapse
    110321591 (Bcl2)
   04722 Neurotrophin signaling pathway
    110321591 (Bcl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321591 (Bcl2)
   05206 MicroRNAs in cancer
    110321591 (Bcl2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110321591 (Bcl2)
   05226 Gastric cancer
    110321591 (Bcl2)
   05215 Prostate cancer
    110321591 (Bcl2)
   05222 Small cell lung cancer
    110321591 (Bcl2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110321591 (Bcl2)
   05022 Pathways of neurodegeneration - multiple diseases
    110321591 (Bcl2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110321591 (Bcl2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110321591 (Bcl2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110321591 (Bcl2)
   05152 Tuberculosis
    110321591 (Bcl2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110321591 (Bcl2)
   05161 Hepatitis B
    110321591 (Bcl2)
   05162 Measles
    110321591 (Bcl2)
   05168 Herpes simplex virus 1 infection
    110321591 (Bcl2)
   05169 Epstein-Barr virus infection
    110321591 (Bcl2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110321591 (Bcl2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110321591 (Bcl2)
   01524 Platinum drug resistance
    110321591 (Bcl2)
   01522 Endocrine resistance
    110321591 (Bcl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110321591 (Bcl2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110321591 (Bcl2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 110321591
NCBI-ProteinID: XP_021053579
Ensembl: MGP_PahariEiJ_G0027722
LinkDB
Position
5
AA seq 236 aa
MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADSAPRGAAPTPGVFSFQPESNPTPA
VHRDTAARTSPLRPLIATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTP
FTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNR
HLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
NT seq 711 nt   +upstreamnt  +downstreamnt
atggcgcaagccgggagaacagggtatgataaccgggagatcgtgatgaagtacatacat
tataagctgtcacagaggggctacgagtgggatgctggagatgcggactcggcgccccgg
ggagctgcccccacccctggcgtcttctccttccagcctgagagcaacccaacgcccgct
gtgcaccgggacacggctgccaggacatctcctctacggcccctcattgccaccgctggg
cctgcgctcagccctgtgccacctgtggtccacctgaccctccgccgggctggggatgac
ttctctcgtagataccgtcgtgacttcgcagagatgtccagtcagctgcacctgacgccc
ttcaccgcgaggggacgctttgccacggtggtggaggaactcttcagggatggggtgaac
tgggggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagagcgtcaac
agggagatgtcacccctggtggacaacatcgccctgtggatgactgagtacctgaaccgg
catctgcacacctggatccaggataacggaggctgggatgcctttgtggagctgtatggc
cccagcatgcgacctctgtttgatttctcctggctgtctctgaagaccctgctcagcctg
gccctggtcggggcctgcatcactctgggtgcatacctgggccacaagtga

DBGET integrated database retrieval system