KEGG   Mus pahari (shrew mouse): 110321613
Entry
110321613         CDS       T05929                                 

Gene name
Per2
Definition
(RefSeq) period circadian protein homolog 2 isoform X1
  KO
K02633  period circadian protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
mpah04713  Circadian entrainment
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110321613 (Per2)
   04713 Circadian entrainment
    110321613 (Per2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110321613 (Per2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110321613 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpah03400]
    110321613 (Per2)
DNA repair and recombination proteins [BR:mpah03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    110321613 (Per2)
SSDB
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Other DBs
NCBI-GeneID: 110321613
NCBI-ProteinID: XP_021053617
Ensembl: MGP_PahariEiJ_G0027660
LinkDB
Position
5
AA seq 1257 aa
MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDSGK
ELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLRELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTMEQVEGIT
SEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQ
GAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESRRRRSGIFKTSGKIQTKSHVSHESGGQKEVSVA
EMQSSPPAQVKAVTTIERDSSGASLPKANFPEELTYKNQPPCSYQQISCLDSVIRYLESC
SEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDVASGPESLDGAAGGLSQEKGPLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGIESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLLGLNATAWSPSDTSQSSCPSAPFPAAVP
AYPLPVFQAPGIVSTPGTVVAPPAAAHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYSFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSSLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGT
SRDRQPKAPPTCNEPSDTQNSDAISTSSDLINLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGCDTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMITDTEESEQFIKYVLQDPIWL
LMANTDDSIMMTYQLPSRDLQTVLKEDQEKLKLLQRSQPRFTEGQRRELQEVHPWVHTGG
LPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTSPRKEAQT
NT seq 3774 nt   +upstreamnt  +downstreamnt
atgaatggatacgtggacttctccccaagtcccaccagccccaccaaggagccaggggca
ccccagcccacccaggctgtgctccaggaagacgtggacatgagcagcggctccagcgga
aacgagaactgctccacggggcgggactctcagggcagtgactgcgacgacagtgggaag
gagctgcgaatgctagtggaatcttccaacactcaccccagccctgatgatgccttcaga
ctcatgatgacagaggcagagcacaacccgtccacgagtggctgcagtagtgagcagtct
gccaaagctgatgcacacaaagaactgataaggaccctgagggaactgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacactggcaaccctgaagtatgccctg
cggagtgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagtgtggatgtgccttcctacaccatggagcaggttgagggcattacc
tccgagtatatcgtgaagaacgcggatatgtttgctgtggctgtgtccctggtttctggg
aagatcctgtacatctctaaccaagtggcctccatctttcactgcaagaaggacgccttc
agtgacgccaagtttgtggagttcctggctcctcatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgtgcagtggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagcag
ggtgctgagagccagctctgctgcctgctgctggcagagagggtacactcaggctatgaa
gctcctagaattcctcctgagaagagaattttcacaacgacccacacaccaaactgcttg
ttccaggatgtggatgaaagggcagtccccctcctgggctatctacctcaggatctgatc
gagacccctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccggtgggcagcctttcgattattctcccattcgattccgcacc
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccatggagc
aggaagatatctttcatcatcgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccgtgcccagaggagaagactccgcaccccagcgttcaggagctc
acagagcaaatccaccgtctgctgatgcagcctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaacggtcaggaggagtctcgccggaggagatccggaatttttaaaaccagtggcaag
attcaaaccaaaagtcacgtctctcatgagtctggaggacagaaggaagtgtctgttgca
gaaatgcaaagcagccccccagctcaggtgaaagctgtcaccaccatagaaagggacagc
tcaggggccagcctacccaaggccaacttcccagaggaactaacctataagaaccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
agtgaggcagccaccctgaaaaggaagtgcgagttcccagccaatatcccatcccggaag
gccacagtcagcccggggctgcactctggagaggcggcgcggccttccaaggtgaccagc
cacacagaagtcagtgctcatctgagctccctgacactgccaggcaaggctgagagtgtg
gtgtccctcaccagccagtgcagctacagtagcaccatcgtgcacgtgggcgacaaaaag
ccacagcccgagctagagacagtagaagatgtggccagtgggcccgagtccctggatggt
gcagccggcggcctcagccaagaaaaggggcctcttcagaagctgggcctcaccaaggaa
gttctggctgcacatacgcagagagaggagcagggcttcctgcagaggttcagggaagtg
agcaggctcagtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
caggcgagtgatcgaggactaagaaatacttctggaatagagtcatcttggaaaaaaact
ggaaagaacaggaaactgaagtccaagcgcgtcaagactcgggactcttctgagagcaca
gggtctggaggaccggtgtcccaccgacctcccctcctgggcctgaatgccacagcctgg
tcaccctccgacacatcccagtccagctgcccctccgcacccttccctgccgcagtgcca
gcttaccccctacctgtgttccaggcacccggaatagtatccacaccggggacagtggtg
gcgccacctgcagccgcccacaccggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccgttcgctgcccccttggctcctgtcatggccttc
atgctgcccagctactcgttcccaccagcaaccccaaacctgcctcaggccttcctcccc
agccagcctcactttccagcccaccccacgcttgcctctgaaataactccagcctcccag
gctgagttccctagtcggacctcgtcgctcagacagccgtgcgcttgcccggtcacccct
ccggccggcacagtggccctgggcagggcctccccaccgctcttccagtcccgaggcagc
agtcccctgcagcttaacctgcttcagctagaggaggcgcctgaaggcagcactggggcc
gcagggaccctggggaccacagggacagcagcttctggtctggactgcacatctggcaca
tctcgggatcggcagccaaaggcacctccaacatgcaacgagccctcagacacccagaat
agcgatgccatctccacgtcaagtgacctgatcaacctcctcctgggcgaggacctctgc
tcagccaccggctcagccctgtctagaagcggggcgtccgccacctcagactctctgggc
tccagctcgctgggctgcgacacatcccaaagtggggcaggcagtagtgacacgagtcac
accagcaaatactttggaagcattgactcttcggagaataatcacaaagcaaaaatgatc
acagacacggaggaaagtgaacagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacagcatcatgatgacataccagctgccttcccgggatctc
cagacggtgttgaaggaggaccaggagaagctgaaactgctgcagaggtcccagccccgg
ttcacagagggccagaggcgagagctacaagaggttcatccgtgggtccacactgggggc
ctgcccacagccattgacgtgacgggctgtgtttactgcgagagtgaggagaaaggcaac
atttgtctgccatatgaggaagacagtccttctccgggactctgtgatacctcagaagcc
aaagaggaggaaggcgaacagctgacaagccccaggaaagaggcccagacgtaa

DBGET integrated database retrieval system