KEGG   Mus pahari (shrew mouse): 110321649
Entry
110321649         CDS       T05929                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04380  Osteoclast differentiation
mpah04390  Hippo signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05410  Hypertrophic cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110321649 (Tgfb2)
   04350 TGF-beta signaling pathway
    110321649 (Tgfb2)
   04390 Hippo signaling pathway
    110321649 (Tgfb2)
   04068 FoxO signaling pathway
    110321649 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110321649 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110321649 (Tgfb2)
   04218 Cellular senescence
    110321649 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110321649 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110321649 (Tgfb2)
   05206 MicroRNAs in cancer
    110321649 (Tgfb2)
   05205 Proteoglycans in cancer
    110321649 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110321649 (Tgfb2)
   05212 Pancreatic cancer
    110321649 (Tgfb2)
   05225 Hepatocellular carcinoma
    110321649 (Tgfb2)
   05226 Gastric cancer
    110321649 (Tgfb2)
   05220 Chronic myeloid leukemia
    110321649 (Tgfb2)
   05211 Renal cell carcinoma
    110321649 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110321649 (Tgfb2)
   05161 Hepatitis B
    110321649 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110321649 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110321649 (Tgfb2)
   05144 Malaria
    110321649 (Tgfb2)
   05145 Toxoplasmosis
    110321649 (Tgfb2)
   05140 Leishmaniasis
    110321649 (Tgfb2)
   05142 Chagas disease
    110321649 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110321649 (Tgfb2)
   05321 Inflammatory bowel disease
    110321649 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110321649 (Tgfb2)
   05414 Dilated cardiomyopathy
    110321649 (Tgfb2)
   05415 Diabetic cardiomyopathy
    110321649 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110321649 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110321649 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110321649 (Tgfb2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110321649 (Tgfb2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110321649 (Tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta Disaggr_repeat SPEG_u2
Other DBs
NCBI-GeneID: 110321649
NCBI-ProteinID: XP_021053683
Ensembl: MGP_PahariEiJ_G0028258
LinkDB
Position
5
AA seq 442 aa
MHYCVLSTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHSPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYASGDQKTIKSTRK
KTSGKTPHLLLMLLPSYRLESQQSSRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGNTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcacctttttgctcctgcatctggtcccggtggcgctcagt
ctgtctacctgcagcaccctcgacatggatcagtttatgcgcaagaggatcgaggccatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaagactatccggagccg
gatgaggtccccccggaggtgatttccatctacaacagtaccagggacttactgcaggag
aaggcaagccggagggcagccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttataaaatcgacatgccgtcccactccccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttttgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaatcgtccgcttt
gatgtctcaacaatggagaaaaatgcttcgaatctggtgaaggcagagttcagggtcttc
cgcttgcagaaccccaaagccagagtggccgaacagcggattgaactataccagatcctt
aaatccaaagacttaacatctcccacccagcgctacattgatagcaaggttgtgaaaacc
agagcggagggtgaatggctttcctttgacgtgacggatgccgtgcaggagtggcttcac
cacaaagacaggaacctggggtttaaaataagtttacactgcccctgctgtaccttcgtg
ccgtctaataattacatcatcccgaataaaagcgaagagctggaggcgagattcgcaggt
attgatggcacctctacatatgccagtggtgatcagaaaactataaagtccactaggaaa
aaaaccagtgggaagaccccacatctcctgctaatgttgttgccctcctacagactggag
tcacaacagtccagccggcggaagaagcgcgcattggatgctgcctattgctttagaaat
gtgcaggataattgctgccttcgccctctttacattgactttaagagggatcttggatgg
aaatggatccatgaacccaaagggtacaatgctaacttctgtgctggggcatgcccctat
ctatggagttcagacactcaacacaccaaagtcctcagcctgtacaacaccataaacccc
gaagcgtccgcttccccttgctgtgtgtcccaggatctggagccactgaccatcctctac
tacattggcaatacacccaaaattgaacagctttccaacatgatcgtcaagtcctgtaaa
tgcagctaa

KEGG   Mus pahari (shrew mouse): 110324521
Entry
110324521         CDS       T05929                                 

Gene name
Tgfb3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04390  Hippo signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05410  Hypertrophic cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110324521 (Tgfb3)
   04350 TGF-beta signaling pathway
    110324521 (Tgfb3)
   04390 Hippo signaling pathway
    110324521 (Tgfb3)
   04068 FoxO signaling pathway
    110324521 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110324521 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110324521 (Tgfb3)
   04218 Cellular senescence
    110324521 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324521 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110324521 (Tgfb3)
   05212 Pancreatic cancer
    110324521 (Tgfb3)
   05225 Hepatocellular carcinoma
    110324521 (Tgfb3)
   05226 Gastric cancer
    110324521 (Tgfb3)
   05220 Chronic myeloid leukemia
    110324521 (Tgfb3)
   05211 Renal cell carcinoma
    110324521 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110324521 (Tgfb3)
   05161 Hepatitis B
    110324521 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110324521 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110324521 (Tgfb3)
   05144 Malaria
    110324521 (Tgfb3)
   05145 Toxoplasmosis
    110324521 (Tgfb3)
   05140 Leishmaniasis
    110324521 (Tgfb3)
   05142 Chagas disease
    110324521 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110324521 (Tgfb3)
   05321 Inflammatory bowel disease
    110324521 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110324521 (Tgfb3)
   05414 Dilated cardiomyopathy
    110324521 (Tgfb3)
   05415 Diabetic cardiomyopathy
    110324521 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110324521 (Tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110324521 (Tgfb3)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110324521 (Tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110324521
NCBI-ProteinID: XP_021057822
Ensembl: MGP_PahariEiJ_G0029732
LinkDB
Position
7
AA seq 412 aa
MKMHLQRALVVLALLNLATISLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPS
VMTHVPYQVLALYNSTRELLEEMQGEREEGCTQETSESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NVHEVMEIKFKGVDNEDDHGRGDLGRLKRQKDHHNPHLILMMIPPHRLDSPGQASQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaacttggccacaatc
agcctctctctgtccacttgcaccacgttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccgtcg
gtgatgacccacgtcccctatcaggtcctggcactttacaacagcacccgggagttgctg
gaagagatgcaaggggagagggaagaaggctgcactcaggagacctcggagtccgagtac
tatgccaaagagatccataaattcgacatgatccaggggctggcggagcacaatgaactg
gccgtctgccccaaaggaattacctctaaggtttttcgtttcaatgtgtcctcagtggag
aaaaatggaaccaatctgttccgggcagagttccgggtcttgcgggtgcccaaccccagc
tccaagcgcacagagcagagaattgagctcttccagatacttcgaccggatgagcacata
gccaagcagcgctacataggtggcaagaacctgcccacgaggggcactgctgagtggctg
tcttttgatgtcaccgacactgtgcgcgagtggctgttgcggagagagtccaacttgggt
ctggaaatcagcatccactgtccatgtcacacctttcagcccaatggagacatactggaa
aatgttcatgaggtgatggaaatcaaattcaaaggagtggacaatgaagatgaccatggc
cgtggagacctggggcgactcaagaggcagaaggaccaccacaacccacacctgatcctc
atgatgatccccccacatcgactggacagcccaggccaggccagtcagaggaagaagagg
gccctggacaccaattactgcttccgcaacctggaggagaactgctgtgtgcgccctctc
tatattgacttccggcaggatctaggctggaaatgggtccacgaacctaagggttactat
gccaacttctgctcaggcccttgcccatacctccgcagcgcggacacaacccacagcacg
gtgcttggactatacaacaccctgaacccagaggcatctgcctcgccatgctgcgtaccc
caggacctggagcccctgaccatattgtactatgtgggcagaacccccaaggtagagcag
ctgtccaacatggtggtgaagtcttgtaagtgcagctga

KEGG   Mus pahari (shrew mouse): 110336543
Entry
110336543         CDS       T05929                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta-1 isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04380  Osteoclast differentiation
mpah04390  Hippo signaling pathway
mpah04659  Th17 cell differentiation
mpah04672  Intestinal immune network for IgA production
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05144  Malaria
mpah05145  Toxoplasmosis
mpah05146  Amoebiasis
mpah05152  Tuberculosis
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05410  Hypertrophic cardiomyopathy
mpah05414  Dilated cardiomyopathy
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110336543 (Tgfb1)
   04350 TGF-beta signaling pathway
    110336543 (Tgfb1)
   04390 Hippo signaling pathway
    110336543 (Tgfb1)
   04068 FoxO signaling pathway
    110336543 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110336543 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110336543 (Tgfb1)
   04218 Cellular senescence
    110336543 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110336543 (Tgfb1)
   04672 Intestinal immune network for IgA production
    110336543 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110336543 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110336543 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336543 (Tgfb1)
   05205 Proteoglycans in cancer
    110336543 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110336543 (Tgfb1)
   05212 Pancreatic cancer
    110336543 (Tgfb1)
   05225 Hepatocellular carcinoma
    110336543 (Tgfb1)
   05226 Gastric cancer
    110336543 (Tgfb1)
   05220 Chronic myeloid leukemia
    110336543 (Tgfb1)
   05211 Renal cell carcinoma
    110336543 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110336543 (Tgfb1)
   05161 Hepatitis B
    110336543 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110336543 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    110336543 (Tgfb1)
   05144 Malaria
    110336543 (Tgfb1)
   05145 Toxoplasmosis
    110336543 (Tgfb1)
   05140 Leishmaniasis
    110336543 (Tgfb1)
   05142 Chagas disease
    110336543 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110336543 (Tgfb1)
   05321 Inflammatory bowel disease
    110336543 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    110336543 (Tgfb1)
   05414 Dilated cardiomyopathy
    110336543 (Tgfb1)
   05415 Diabetic cardiomyopathy
    110336543 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110336543 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110336543 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mpah03110]
    110336543 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110336543 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110336543 (Tgfb1)
Chaperones and folding catalysts [BR:mpah03110]
 Intramolecular chaperones
  Others
   110336543 (Tgfb1)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   110336543 (Tgfb1)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110336543 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 110336543
NCBI-ProteinID: XP_021074814
Ensembl: MGP_PahariEiJ_G0021232
LinkDB
Position
19
AA seq 390 aa
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAI
YEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWR
YLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS
PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctactgccgcttctgctcccactcccgtggcttctagtg
ctgacgcccgggaggccagccgcgggactctccacctgcaagaccatcgacatggagctg
gtgaaacggaagcgcatcgaagccatccgtggccagatcctgtccaaactacggctcgcc
agtcccccgagccagggggaggtaccgcccggcccgctgcccgaggcggtgctcgctttg
tacaacagcacccgcgaccgggtggcaggcgagagcgccgacccggagccggagcccgaa
gcggactactacgctaaagaggtcacccgcgtgctaatggtggaccgcaacaacgccatc
tatgagaagaccaaagacatctcgcacagtatatatatgttcttcaatacgtcagacatt
cgggaagcagtaccggaacccccattgctgtcccgtgcagagctgcgcctgcagagatta
aaatcaagtgtggagcaacatgtggaactctaccagaaatatagcaacaattcctggcgt
taccttggtaaccggctgctgacccccactgatacgcctgagtggctgtcttttgatgtc
actggagttgtacggcagtggctgaaccagggagacggaatacagggctttcgcttcagc
gctcactgctcttgtgacagcaaagataacaaactccacgtggaaatcaatgggatcagt
cccaaacgtcgaggcgacctgggcaccatccatgacatgaaccgacccttcctgctcctc
atggccacccccctggaaagggcccagcacctgcacagctcacggcaccggagagccctg
gataccaactattgcttcagctccacagagaagaactgctgtgtgcggcaactgtacatc
gactttaggaaggacctgggttggaagtggatccacgaacccaagggctaccatgccaac
ttctgtctggggccctgcccctacatttggagcctggacacacagtacagcaaggtcctt
gctctctacaaccaacacaatccgggcgcttcggcgtcaccgtgctgcgtgccgcaggct
ttggagccactgcccatcgtctactacgtgggtcgcaagcccaaggtggagcagttgtcc
aacatgattgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system