KEGG   Mus pahari (shrew mouse): 110321776
Entry
110321776         CDS       T05929                                 

Gene name
Tp53bp2
Definition
(RefSeq) apoptosis-stimulating of p53 protein 2
  KO
K16823  apoptosis-stimulating of p53 protein 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110321776 (Tp53bp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110321776 (Tp53bp2)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110321776 (Tp53bp2)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank Ank_3 SH3_1 SH3_9 Ank_5 SH3_2 ATG16
Other DBs
NCBI-GeneID: 110321776
NCBI-ProteinID: XP_021053912
Ensembl: MGP_PahariEiJ_G0028233
LinkDB
Position
5
AA seq 1134 aa
MRFGSKMMPMFLTVYLSNSEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSER
PVADNERMFDVLQRFGSQRNEVRFFLRHERPPSRDIVSGPRSQDSSVKRNGVKVPSEHRR
KENGVNSPRLDLTLAELQEMASRQQQQIEAQQQMLATKEQRLKFLKQQDQRQQQQAAEQE
KLKRLREIAESQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNSLFQQKQRELVLAVSK
VEELTRQLEMLKNGRIDGHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKR
NSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSPDGNLPQQAVSAPSRVAAVGPYIQSS
TMPRMPSRPELLVKPALPDGSLVMQSAEGPMKMQTLPNMRSGAASQSKGSKAHPASPDWN
PSNADLLPSQGSSVPQSAGNALDQVDDGEIAVREKEKKVRPFSMFDTVDQCAAPPSFGTL
RKNQSSEDILRDAQAVNKNVAKVPPPVPTKPKQINLPYFGQTAQSPSDMKPDGNPQQLPT
AATSVGAKLKPAGPQARMLLSPGAPSGGQDQVLSPASKQESPPAAAVRPFTPQPSKDTFP
PAFRKPPTVAASSIYSMYTQHQAPGKNFQQAVQSALTKAHPRGPHFSSVYGKPVIAAAQN
PQQHPENIYSCSQGKPGSPEPEIEPVSSVHESHENERIPRPLSPTKLLPFLSNPYRNQSD
ADLEALRKKLANAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSCPPKSP
GSVTANPDSTIEIPNPYLHVEPEKEVGSLVPEPLSPEDMGSASTENSDVPAPSPGLEYVS
ERVTDSSSNLQNNIEETNPEAPHLLEAYLEEYPPYPPPPYPSGEPEVSEEDSARMRPPEI
TGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSL
PNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVES
GAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQHDD
ELLMKEGDCMTVVRREDEEEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgcggttcgggtccaaaatgatgccgatgttcctgacagtttacctcagtaacagtgag
cagcacttcacagaagttcctgttaccccagagacaatatgcagagatgtggtggatctg
tgcaaggagcctggagagagcgactgccatttagctgaagtgtggtgtggctctgaacgc
ccagttgctgataatgaacggatgtttgatgttcttcagcggtttggaagtcaaaggaat
gaagttcgcttctttcttcgtcatgaacgcccccctagcagggacattgtcagtggaccg
agatcccaagattcaagtgtaaaaagaaatggtgtcaaagttcccagtgagcatcggagg
aaggagaatggagttaacagtcctaggctggacctgacgcttgctgaactccaggaaatg
gcatctcgccagcagcagcagatcgaggcccagcaacaaatgctggctactaaggagcaa
cgcttaaagtttttaaaacagcaagatcaacgtcaacagcaacaagctgctgaacaggag
aaacttaagaggcttagagaaatagctgaaagtcaggaagctaagcttaagaaagtgaga
gcactcaagggccatgtggagcagaagaggctgagcaacggaaaacttgtggaggaaatt
gaacaaatgaatagcttgttccagcagaaacagagggagctagttctggctgtgtctaaa
gtagaggaactgacaagacagctggagatgctgaagaacggcaggatcgatggccaccat
gacaaccagtcggccgtggctgagctagaccgcctttacaaggaactgcagttaagaaac
aaactgaaccaagagcagaatgccaaactgcaacaacagagggagtgtttgaataagcgc
aattcagaagtggcagtcatggataagcgcgtcaatgagctgagggaccggctgtggaag
aagaaggcagcactgcagcagaaagagaatctcccggtttcacctgatggaaatcttccc
caacaagcagtgtcagccccaagtcgtgtggctgctgtaggcccttacatccagtcatcc
actatgccacggatgccctccagacccgagctgctcgtgaagccagccctgcctgacggc
tccttggtcatgcagtcagcagaggggccaatgaagatgcagacactgcccaatatgagg
tctggggctgcttcacaaagtaaaggctctaaagctcacccagctagccctgattggaac
ccttctaatgccgacctcttacccagccaaggctcttctgtaccccagagtgctggaaat
gctctggaccaagttgacgatggggagattgctgtgagggagaaagagaagaaagtgcgt
cctttttccatgtttgacacagtggaccaatgtgctgccccaccctcctttggtaccctg
aggaaaaaccagagcagcgaggacatcttgcgggatgctcaggctgtaaataaaaatgta
gctaaagtaccacctcctgttcctacaaagccaaaacagattaatttgccttactttgga
caaactgctcagtcaccttctgacatgaagccagatggaaatcctcagcaattgccaaca
gctgctacatccgtgggggctaagctcaagccagcagggccacaggcaaggatgctgctg
tctcctggtgccccttcaggtggtcaggaccaagtcctgtctccagcatctaagcaagaa
agtcctcctgctgctgcagtccggcccttcacgccccagccatccaaggacaccttccct
ccagcctttcgcaaacccccaactgtggcagcaagctctatctattccatgtacacccag
catcaggcaccaggaaaaaacttccagcaggctgtgcagagcgccttgaccaaggcgcac
cccagaggcccccacttttcaagtgtgtatggcaagcctgtgatagctgctgcccagaac
ccacagcagcatccagagaacatttactcctgtagccaggggaagcctggcagtccggag
cccgagattgagcccgtttcttcagttcatgagagtcatgaaaatgaaaggattcctcga
ccactcagtccaacgaaattattgcctttcttgtctaacccttaccgaaaccagagcgat
gctgacttagaagccctgcggaaaaaactggctaatgccccacggccactaaagaaacgt
agctccatcacagaaccagaaggcccgaatgggccaaatattcagaaacttttgtatcag
aggaccaccatagctgccatggagaccatctcggtcccgtcgtgcccacctaagtcgcca
ggctcagtgactgccaatccagacagcacaattgaaatcccaaatccatatttacatgtg
gagccggagaaggaggtgggctctttagtccctgaaccactgtccccagaggatatgggg
agtgccagtacagagaacagtgacgtgccagctccttctccaggccttgagtatgtgtct
gagagagtcacagacagcagttcgaatctgcagaataacatagaagaaacaaacccagag
gctccccacttacttgaagcatacctagaagaataccccccatacccacctcctccatac
ccatctggggaaccagaggtgtccgaagaggactccgcacgtatgcgcccacctgaaatc
accgggcaggtgtctctgcctcctggcaaaaggacaaacttgcggaaaactggctccgag
cggattgctcatgggatgagggtgaaattcaacccccttgctttgctcctagattcatct
ctggagggagagtttgatcttgtacagagaattatctatgaggttgatgacccaagcctg
ccaaatgatgagggcatcacagctcttcataatgctgtgtgtgcaggccacacagaaatt
gtgaagttcctggtacagtttggtgtgaatgtaaatgcagcagatagtgatggatggaca
ccattgcattgtgctgcctcctgtaacaatgtccaagtgtgtaagttcctggtggagtcg
ggagcagctgtgtttgctatgacctacagtgacatgcagactgctgcagacaagtgtgag
gaaatggaggaaggctacacgcagtgctcccagtttctctatggcgttcaggagaagatg
ggcataatgaacaaaggcgtcatttacgcactgtgggattacgagccgcagcatgatgat
gagctgctcatgaaagaaggagactgcatgaccgtcgtccgcagagaagatgaagaggaa
atcgagtggtggtgggcacgccttaacgataaggaaggatatgttcctcgcaacttgcta
ggactatacccaagaattaaaccaagacaaaggagcttggcctga

DBGET integrated database retrieval system