KEGG   Mus pahari (shrew mouse): 110322061
Entry
110322061         CDS       T05929                                 

Gene name
Aim2
Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04621  NOD-like receptor signaling pathway
mpah04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110322061 (Aim2)
   04623 Cytosolic DNA-sensing pathway
    110322061 (Aim2)
SSDB
Motif
Pfam: PYRIN HIN Fibrinogen_BP ProQ_C
Other DBs
NCBI-GeneID: 110322061
NCBI-ProteinID: XP_021054252
Ensembl: MGP_PahariEiJ_G0028153
LinkDB
Position
5
AA seq 253 aa
MESEYREMLLLTGLDHITEEELKRFKYFALTEFQIARSTLNVADRTELADQLIQSAGAAS
AVTKAINIFQKLNYRHIANALEEKKKEAECKFMTNTKKRGTQKVENRSQAENCSAASATR
SDKDVKEQAATEVCPQAKPQKKQMVAEQEAIREDLQKDPLVVMVLKDLTHIFLSQITEQK
DRILYGIHDKTGTMEVLVLGNPSKTKCEEGDKIRLTFFEVSKNGVKIQLKSGPCSFFKVI
KAAKPKSGMKSVE
NT seq 762 nt   +upstreamnt  +downstreamnt
atggagagcgaatacagggaaatgctgttgttgaccggcctagatcacatcacagaggag
gaactgaaacggttcaaatattttgctttgactgagtttcagattgccaggagcacactc
aacgttgcagataggacagagttagctgaccaactgattcaaagtgcaggtgcagcgtct
gcggtgacaaaggccattaatattttccagaagttgaattataggcatattgcaaatgct
cttgaagagaaaaagaaagaagctgaatgtaaattcatgaccaatacaaagaagagagga
acacagaaggtagaaaatagaagtcaagctgaaaactgctctgctgcctctgccacccgc
agtgacaaagatgtcaaggaacaggctgctacagaagtctgtcctcaagctaagcctcag
aagaaacagatggtggcagaacaggaagccatcagagaagacttacagaaagatccactt
gtagtcatggtgctgaaagacttgactcatattttcctttcacagataacagagcaaaaa
gatagaatattgtatggtatacatgataaaacagggacgatggaggtgttggtgctggga
aacccaagcaaaacaaagtgcgaggaaggagacaagatcagactcactttctttgaggtg
tcaaaaaatggagtgaaaattcagttgaaatctggaccttgtagcttctttaaggttatt
aaggctgcaaaaccaaaatctgggatgaaaagtgtggagtga

DBGET integrated database retrieval system