KEGG   Mus pahari (shrew mouse): 110322378
Entry
110322378         CDS       T05929                                 

Gene name
Ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04218  Cellular senescence
mpah04310  Wnt signaling pathway
mpah04340  Hedgehog signaling pathway
mpah04371  Apelin signaling pathway
mpah04390  Hippo signaling pathway
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04630  JAK-STAT signaling pathway
mpah04917  Prolactin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah04934  Cushing syndrome
mpah05160  Hepatitis C
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05216  Thyroid cancer
mpah05218  Melanoma
mpah05219  Bladder cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110322378 (Ccnd1)
   04340 Hedgehog signaling pathway
    110322378 (Ccnd1)
   04390 Hippo signaling pathway
    110322378 (Ccnd1)
   04371 Apelin signaling pathway
    110322378 (Ccnd1)
   04630 JAK-STAT signaling pathway
    110322378 (Ccnd1)
   04068 FoxO signaling pathway
    110322378 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    110322378 (Ccnd1)
   04152 AMPK signaling pathway
    110322378 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110322378 (Ccnd1)
   04115 p53 signaling pathway
    110322378 (Ccnd1)
   04218 Cellular senescence
    110322378 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110322378 (Ccnd1)
   04530 Tight junction
    110322378 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110322378 (Ccnd1)
   04921 Oxytocin signaling pathway
    110322378 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    110322378 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322378 (Ccnd1)
   05206 MicroRNAs in cancer
    110322378 (Ccnd1)
   05205 Proteoglycans in cancer
    110322378 (Ccnd1)
   05203 Viral carcinogenesis
    110322378 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110322378 (Ccnd1)
   05212 Pancreatic cancer
    110322378 (Ccnd1)
   05225 Hepatocellular carcinoma
    110322378 (Ccnd1)
   05226 Gastric cancer
    110322378 (Ccnd1)
   05214 Glioma
    110322378 (Ccnd1)
   05216 Thyroid cancer
    110322378 (Ccnd1)
   05221 Acute myeloid leukemia
    110322378 (Ccnd1)
   05220 Chronic myeloid leukemia
    110322378 (Ccnd1)
   05218 Melanoma
    110322378 (Ccnd1)
   05219 Bladder cancer
    110322378 (Ccnd1)
   05215 Prostate cancer
    110322378 (Ccnd1)
   05213 Endometrial cancer
    110322378 (Ccnd1)
   05224 Breast cancer
    110322378 (Ccnd1)
   05222 Small cell lung cancer
    110322378 (Ccnd1)
   05223 Non-small cell lung cancer
    110322378 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110322378 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322378 (Ccnd1)
   04934 Cushing syndrome
    110322378 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322378 (Ccnd1)
   05162 Measles
    110322378 (Ccnd1)
   05160 Hepatitis C
    110322378 (Ccnd1)
   05163 Human cytomegalovirus infection
    110322378 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110322378 (Ccnd1)
   05169 Epstein-Barr virus infection
    110322378 (Ccnd1)
   05165 Human papillomavirus infection
    110322378 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110322378 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 110322378
NCBI-ProteinID: XP_021054696
Ensembl: MGP_PahariEiJ_G0013956
LinkDB
Position
1
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQKEIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQTIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNSFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNVNPKATEEEGEAEEEAGLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgctgcgagccatgctcaagacggaggagacctgtgcgccc
tccgtatcttacttcaagtgcgtgcagaaggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtccctggaacccctgaagaagagccgcctgcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccattcccctgact
gccgagaaattgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactgcttctggtgaacaagctcaagtggaacctggctgccatgactccccacgacttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagaccatccgcaag
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccgccc
tccatggtagctgctgggagcgtggtggctgccatgcaaggcctgaacctgggcagcccc
aacagcttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggactgcctccgtgcctgccaggaacagattgaagcccttctggagtcaagcctgcgc
caggcccagcagaacgtcaaccccaaggccacggaggaggagggggaagcggaggaagag
gctggtctggcctgcacacccaccgacgtgcgagatgtggacatctga

DBGET integrated database retrieval system