KEGG   Mus pahari (shrew mouse): 110322671Help
Entry
110322671         CDS       T05929                                 

Gene name
Lsp1
Definition
(RefSeq) lymphocyte-specific protein 1 isoform X1
  KO
K14957  lymphocyte-specific protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04625  C-type lectin receptor signaling pathway
mpah05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110322671 (Lsp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110322671 (Lsp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 110322671
NCBI-ProteinID: XP_021055053
Ensembl: MGP_PahariEiJ_G0013920
LinkDB All DBs
Position
1
AA seq 329 aa AA seqDB search
MAEAARDPRCEEQEELHAEDGEGLTTQWREEDEEEAAREQRQRERERQLQDQDKDEDEGG
HSLEQPGQQSLISLKCSELDEDEGFGDWSQKPEPRQQFWGNEGTAEGTEPSQSERPEEKQ
TEESSHQAKVHLEESNLSYREPNPEDAAGGSGEAEEHLIRHQVRTPSPLALEDTVELSSP
PLSPTTKLADRTESLNRSIKKSNSVKKSQPTLPISTIDERLRQYAQATESSGRTPKLSRQ
PSIELPSMAVASTKTRWETGEVQSQSASKTPFCQDIVAGDMSKKSLWEQKGGSKISSTIK
STPSGKRYKFVATGHGKYEKVLVDEGSAP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctgccagagatcccagatgcgaggaacaggaagagctccatgcagaagat
ggcgaagggctcacaactcagtggagagaagaagacgaggaagaggctgcccgtgagcag
cgtcagcgggagcgagagaggcagctacaggaccaggacaaagatgaagatgaaggtggc
cattccctggagcagccaggacagcagtcactcatcagcctgaagtgctctgaactggat
gaagatgagggttttggtgactggtcccaaaagccggagccacggcagcaattctggggg
aatgaggggactgcagaggggactgaaccctctcaaagcgagagaccagaggagaaacaa
acagaggagagttctcaccaagccaaagtccatttggaggagtcaaacctgagctacagg
gagcccaatccagaggatgctgctgggggttctggggaggccgaagagcatctgatacgt
catcaggtcaggacccccagccctttggccttagaagacactgttgagctgagttcacct
cccctgagccccaccaccaaactggctgatagaacagagtccctgaaccgctccattaaa
aagagcaacagtgtgaagaagtctcaaccaaccttgcccatttccacaatcgatgaacgc
ctgcggcagtatgcccaggccactgagtcttctggccgaactcctaagctgtcccgccag
ccctccatagagctacccagcatggctgtagccagtaccaagactcgttgggaaacagga
gaggtgcagagtcagtctgcttccaagacacccttctgccaggatatagtagctggagac
atgagcaagaaaagtctgtgggagcagaaaggaggctccaagatctcatccaccatcaag
agcaccccatctggaaagcggtacaagtttgtggccactggacatgggaagtacgagaaa
gttcttgtggacgagggctcagcaccatag

DBGET integrated database retrieval system