KEGG   Mus pahari (shrew mouse): 110322784
Entry
110322784         CDS       T05929                                 

Gene name
Tgfbr1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04144  Endocytosis
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04371  Apelin signaling pathway
mpah04380  Osteoclast differentiation
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04659  Th17 cell differentiation
mpah04926  Relaxin signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05142  Chagas disease
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110322784 (Tgfbr1)
   04350 TGF-beta signaling pathway
    110322784 (Tgfbr1)
   04390 Hippo signaling pathway
    110322784 (Tgfbr1)
   04371 Apelin signaling pathway
    110322784 (Tgfbr1)
   04068 FoxO signaling pathway
    110322784 (Tgfbr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110322784 (Tgfbr1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110322784 (Tgfbr1)
  09143 Cell growth and death
   04218 Cellular senescence
    110322784 (Tgfbr1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110322784 (Tgfbr1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110322784 (Tgfbr1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110322784 (Tgfbr1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110322784 (Tgfbr1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110322784 (Tgfbr1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110322784 (Tgfbr1)
   05212 Pancreatic cancer
    110322784 (Tgfbr1)
   05225 Hepatocellular carcinoma
    110322784 (Tgfbr1)
   05226 Gastric cancer
    110322784 (Tgfbr1)
   05220 Chronic myeloid leukemia
    110322784 (Tgfbr1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110322784 (Tgfbr1)
   05161 Hepatitis B
    110322784 (Tgfbr1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110322784 (Tgfbr1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110322784 (Tgfbr1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110322784 (Tgfbr1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110322784 (Tgfbr1)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110322784 (Tgfbr1)
Protein kinases [BR:mpah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   110322784 (Tgfbr1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase
Other DBs
NCBI-GeneID: 110322784
NCBI-ProteinID: XP_021055202
Ensembl: MGP_PahariEiJ_G0028332
LinkDB
Position
6
AA seq 503 aa
MEAAAAAPRRRQLLIVLVAAATLLPGAKALQCFCHLCTKDNFTCETDGLCFVSVTETTDK
VIHNSMCIAEIDLIPRDRPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAG
LGPVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDL
IYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVE
GMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDS
ATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIGGI
HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGA
ARLTALRIKKTLSQLSQQEGIKM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgcggctccgcgtcgccggcagcttctcatcgtgttggtggcggcg
gcgacgctgctcccgggggcgaaggcattacagtgtttctgccacctctgtacaaaggat
aattttacctgtgagacagatggtctctgctttgtctcagtcactgagaccacagacaaa
gttatacacaatagtatgtgtatagctgaaattgacctaattcctcgagataggccattt
gtttgtgcaccatcttcaaaaacaggggcagtaactacaacatattgctgcaatcaagac
cactgcaataaaatagagctcccaacaacaggacctttttcagaaaagcagtcagctggc
cttggtcctgtggagctggcagctgtcattgctggtccagtctgcttcgtctgcattgca
cttatgctgatggtctatatctgccataaccgcactgtcattcaccaccgtgtgccaaac
gaagaggatccatcactagatcgcccttttatttcagagggcaccaccttaaaagattta
atttatgatatgacaacatcagggtctggatcaggtttaccactgcttgttcaaagaaca
attgccaggaccattgtgttacaagaaagcattggcaaaggtcggtttggagaagtttgg
cgaggcaaatggcggggagaagaagttgctgtgaagatattctcttcgagagaagaacgt
tcatggttccgagaggcagagatttatcagactgtaatgttacgccatgaaaatatcctg
ggatttatagcagcagacaacaaagacaatgggacctggactcagctgtggttggtgtca
gattatcatgagcatggatcccttttcgattacttgaatagatacactgttactgtggaa
ggaatgatcaaacttgctctgtccacggcaagtggtcttgcccatcttcacatggagatt
gttggtacccaaggaaaaccagctattgcccatagagatttgaaatcaaagaatatcttg
gtgaagaaaaatggaacctgttgtattgcagacttgggacttgctgtgagacatgattct
gccacagatacaattgatattgctccaaaccacagagtaggcactaaaaggtacatggcc
cctgaagttctagacgattccataaatatgaaacattttgaatccttcaaacgtgctgat
atctatgcaatgggcttagtattctgggaaattgctcgacgctgttccattggtggaatc
catgaagactaccagttgccttattatgatcttgtaccttctgatccatcggttgaagaa
atgagaaaagtagtttgcgagcagaagttaaggccaaatattccaaacagatggcagagc
tgtgaggccttgagggtgatggctaaaattatgagagaatgctggtatgccaatggggca
gcgaggctgacagctttgcgaattaaaaaaacattgtcacaactcagccaacaggaaggc
atcaaaatgtaa

KEGG   Mus pahari (shrew mouse): 110327573
Entry
110327573         CDS       T05929                                 

Gene name
Tgfbr2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04068  FoxO signaling pathway
mpah04144  Endocytosis
mpah04218  Cellular senescence
mpah04350  TGF-beta signaling pathway
mpah04380  Osteoclast differentiation
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04659  Th17 cell differentiation
mpah04926  Relaxin signaling pathway
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05142  Chagas disease
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05220  Chronic myeloid leukemia
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110327573 (Tgfbr2)
   04350 TGF-beta signaling pathway
    110327573 (Tgfbr2)
   04390 Hippo signaling pathway
    110327573 (Tgfbr2)
   04068 FoxO signaling pathway
    110327573 (Tgfbr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110327573 (Tgfbr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110327573 (Tgfbr2)
  09143 Cell growth and death
   04218 Cellular senescence
    110327573 (Tgfbr2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110327573 (Tgfbr2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110327573 (Tgfbr2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    110327573 (Tgfbr2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110327573 (Tgfbr2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110327573 (Tgfbr2)
   05202 Transcriptional misregulation in cancer
    110327573 (Tgfbr2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110327573 (Tgfbr2)
   05212 Pancreatic cancer
    110327573 (Tgfbr2)
   05225 Hepatocellular carcinoma
    110327573 (Tgfbr2)
   05226 Gastric cancer
    110327573 (Tgfbr2)
   05220 Chronic myeloid leukemia
    110327573 (Tgfbr2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110327573 (Tgfbr2)
   05161 Hepatitis B
    110327573 (Tgfbr2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110327573 (Tgfbr2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    110327573 (Tgfbr2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110327573 (Tgfbr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110327573 (Tgfbr2)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110327573 (Tgfbr2)
Protein kinases [BR:mpah01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110327573 (Tgfbr2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase ABC1 Pkinase_fungal APH Haspin_kinase
Other DBs
NCBI-GeneID: 110327573
NCBI-ProteinID: XP_021062305
Ensembl: MGP_PahariEiJ_G0015649
LinkDB
Position
10
AA seq 592 aa
MGRGLLRGLWPLHIVLWTRIASTIPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNND
VMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNI
TLETVCHDPKLTYHGFTLEDASSPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTT
SSPDLLLVIIQVTGVSLLPPLGIAIAVIVIFYCYRVHRQQKLSPSWESSKPRKLMDFSDN
CAIILEDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVA
VKIFPYEEYSSWKTEKDIFSDTNLKHENILQFLTAEERKTELGKQYWLITAFHAKGNLQE
YLTRHVISWEDLRKLGSSLARGIAHLHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCL
CDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLENVESFKQTDVYSMALVLW
EMTSRCNAVGEVKDYEPPFGSKVREHPCVESMKDSVLRDRGRPEIPSFWLNHQGIQIVCE
TLTECWDHDPEARLTAQCVAERFSELEHPERLSGRSCSQEKIPEDGSLNTTK
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgggtcgggggctgctccggggcctgtggccgctgcatatcgtcctgtggacgcgcatc
gccagcacgatcccgccgcacgttcccaagtctgatgtggaaatggaagcccagaaagat
gcatccatccacctaagctgtaataggaccatccatccactgaaacattttaacaatgat
gtaatggccagcgacaatggcggtgcggtcaagcttccacagctgtgtaagttttgcgat
gtgagattgtccacttgtgacaaccagaagtcctgcatgagcaactgcagtatcacggcc
atctgtgagaagccgcatgaagtctgcgtggccgtgtggaggaagaacgacaagaacatt
actctggaaacggtttgccacgaccccaagctcacctaccacggcttcactctggaagat
gcctcttctcccaagtgtgtcatgaaggaaaaaaaaagggcgggcgagactttcttcatg
tgcgcctgtaacatggaggagtgtaatgattacatcatcttttcggaagaatacaccacc
agtagtcctgacctgttgctggttattatccaagtgacaggcgtcagcctcctgcctcca
ctggggattgccatagctgtcatcgtcatcttctactgctatcgtgtccaccggcagcag
aagttgagcccgtcctgggagagcagcaagccacggaagctcatggatttcagtgataac
tgcgccatcatcctggaggatgaccgctccgacatcagctccacgtgtgccaacaacatc
aaccacaacaccgagctgctgcccatcgagctggacacgctggtggggaagggccgcttt
gccgaggtctacaaggccaagctgaagcagaacacctcagagcagtttgagactgtggct
gtcaagatcttcccctacgaggagtactcctcgtggaaaacggaaaaggacatcttctcc
gacaccaacctgaagcatgagaacatcctgcagttcctgacggccgaggagcggaagacg
gagctgggcaagcagtactggctgatcacagcgttccacgccaagggcaacctccaggag
tacctcacgaggcatgtcatcagctgggaggacctgcggaagctgggcagctccctggcc
cggggcatcgctcatctccacagtgaccacactccttgtgggaggcccaagatgcccatc
gttcacagggacctcaagagctctaacatcctagtgaagaacgacttgacctgttgcctg
tgtgacttcgggctgtccttgcgcctggaccctaccctgtctgtggatgacctggccaat
agcggacaggtgggaacagcaagatacatggccccggaagttctagaatccaggatgaat
ctggaaaacgtggagtcgttcaagcagacggatgtctactccatggctctggtactctgg
gaaatgacttcccgctgcaatgctgtgggagaagtgaaagattacgagcccccatttggg
tccaaggtgcgagagcacccctgtgtggagagcatgaaagacagcgtgctgagagaccga
gggcggcccgaaatccccagcttctggctcaaccaccagggcatccagatcgtgtgtgag
actttgaccgagtgctgggaccatgaccccgaggcccgtctcacagcccagtgtgtggca
gagcgcttcagtgagctggagcacccagagagactctctgggaggagctgctcccaggag
aagattccagaagatggctcgctgaacactaccaaatag

DBGET integrated database retrieval system