KEGG   Mus pahari (shrew mouse): 110323116
Entry
110323116         CDS       T05929                                 

Gene name
Dvl1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110323116 (Dvl1)
   04330 Notch signaling pathway
    110323116 (Dvl1)
   04390 Hippo signaling pathway
    110323116 (Dvl1)
   04150 mTOR signaling pathway
    110323116 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110323116 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110323116 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323116 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110323116 (Dvl1)
   05226 Gastric cancer
    110323116 (Dvl1)
   05217 Basal cell carcinoma
    110323116 (Dvl1)
   05224 Breast cancer
    110323116 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110323116 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323116 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    110323116 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110323116 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 110323116
NCBI-ProteinID: XP_021055869
Ensembl: MGP_PahariEiJ_G0029256
LinkDB
Position
6
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVAGSRDGMDTETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSG
SESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHSLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaaaatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtagcccccgagcgcgtcacgctggcagacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaag
gaggagatcttcgatgacaatgccaagttgccctgcttcaatggccgggtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgatagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catccaaatgttgccggtagccgggacggaatggacactgagacgggcacagagtctatg
gtcagtcaccggcgggagcgagcccgacgtcgaaaccgcgatgaggctgcccggaccaat
gggcatcccagaggggaccggcggcgggacctgggactacctccagacagtgcatccact
gtactgagcagtgagcttgaatctagcagctttattgactcagatgaggaggacaatacg
agccggctgagcagctccacagagcagagcacctcctctcggctaattcgtaagcacaaa
tgccgtcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagtatc
acagactctaccatgtccctgaacatcatcaccgtcactctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggggccgtggctgctgatggccgcattgagccgggcgacatg
ttgctgcaggtgaatgatgtcaactttgagaacatgagcaatgatgatgctgtgcgggtg
cttcgggagatcgtatcccagacagggcctatcagtctcacagtggccaagtgctgggac
ccaacccctcggagctacttcaccatcccaagggctgacccagtgcgacccatcgaccca
gctgcctggctgtctcacacagcagcactgacgggtgctctgcctcgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagcttgaggaggcaccgctgactgtgaagagtgacatgagtgccattgtccgc
gtcatgcagttgccagactcaggactggagatccgggaccgcatgtggcttaagatcacc
attgccaatgctgtcattggggcggatgtggtggactggctgtacacacacgtggagggc
ttcaaggagcgaagggaggcgaggaagtatgccagcagtatgctgaaacatggtttcctg
aggcacacagtgaacaagatcaccttctctgagcagtgctactatgtctttggtgacctg
tgcagcaacctcgcatccctgaacctcaacagtggctccagtggagcctcagatcaggat
acactggccccactgccccacccatcagtaccctggcccttgggtcaaggctacccctac
cagtacccaggacccccgccctgcttcccacctgcttaccaggaccctggcttcagctat
ggcagtggcagtgctggaagtcagcagagtgaagggagcaagagcagtgggtccacaagg
agcagccatcggaccccaggccgagaggaacgccgggcaactggagctgggggtagtggc
agtgaatcagaccacacagtaccaagtgggtctggtagcaccggctggtgggagcggcct
gtcagccagcttagccgtggcagtagccctcgaagtcaggcttcagctgttgccccaggg
ctccccccactgcattcccttacaaaggcctatgcagtagtgggtgggccacctggaggg
ccacctgtccgggagctggctgctgttcctccagaacttacaggtagccgccaatccttc
caaaaggccatgggaaacccctgtgagttctttgtggacatcatgtga

KEGG   Mus pahari (shrew mouse): 110329595
Entry
110329595         CDS       T05929                                 

Gene name
Dvl3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110329595 (Dvl3)
   04330 Notch signaling pathway
    110329595 (Dvl3)
   04390 Hippo signaling pathway
    110329595 (Dvl3)
   04150 mTOR signaling pathway
    110329595 (Dvl3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110329595 (Dvl3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110329595 (Dvl3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329595 (Dvl3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110329595 (Dvl3)
   05226 Gastric cancer
    110329595 (Dvl3)
   05217 Basal cell carcinoma
    110329595 (Dvl3)
   05224 Breast cancer
    110329595 (Dvl3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110329595 (Dvl3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110329595 (Dvl3)
   05022 Pathways of neurodegeneration - multiple diseases
    110329595 (Dvl3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110329595 (Dvl3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 110329595
NCBI-ProteinID: XP_021064974
Ensembl: MGP_PahariEiJ_G0016281
LinkDB
Position
12
AA seq 718 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPSMERTGGIGDSRPPSFHPH
ASGGSQENLDNDTETDSLVSAQRERPRRRDGPEHAARLNGTTKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLTSSLRSHHTHPSYGPPGVPP
LYGPPMLMMTPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPTKNFGLFDFL
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacggccaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcggccc
agctataagttcttcttcaagtctatggacgacgattttggggtggtgaaggaagagatc
tcggatgacaatgccaagctcccctgcttcaatggccgcgtggtgtcctggctggtatct
gccgagggatcacacccagagccggcccctttctgtgcagacaacccgtcagagctgcca
ccttcgatggaacgcacaggaggcattggggactctcgacccccctccttccaccctcat
gctagtgggggcagccaggagaatctggacaatgacacagagaccgattccttggtgtct
gcccaacgagagcggccccgacggagggatggccctgagcacgcggcccgactcaacgga
accacaaagggtgagcggcgccgggagccaggcggctatgacagctcatctaccctcatg
agcagcgagctagagactaccagtttctttgattcagatgaggatgactccaccagcagg
ttcagcagctccacagaacagagcagtgcctcacgcctcatgagaagacacaagcggcgg
cggcggaagcagaaggtctcccggattgagcggtcctcgtcattcagcagcatcacagac
tccaccatgtctctcaatatcatcaccgtcactctcaacatggaaaaatataacttcttg
ggcatctccattgtgggccagagcaatgagcgaggtgatgggggcatctacattggctcc
atcatgaaaggtggagctgtggcagctgatggacgcattgagccaggagatatgctactg
caggtaaatgagatcaacttcgagaacatgagcaacgatgatgcagtccgagtccttcgg
gagattgtgcacaagccagggcccatcactctgactgtagccaagtgctgggacccgagt
cctcgtggctgcttcacattaccccggagtgagcccatccgtcccattgaccctgcagca
tgggtctctcacactgcagccatgacaggcaccttccccgcctatggcatgagcccctcc
ttaagcaccatcacctctaccagctcctccatcaccagctccatccctgatacagagcgc
ctagatgatttccacctctccatccacagtgacatggcggccatcgtaaaagccatggcc
tcccctgagtcagggttggaggtccgagaccgcatgtggctcaagattaccattcccaat
gctttcatcggctcggatgtggtggactggctgtaccacaatgtggaagggttcactgat
cgtcgggaggcccgcaagtatgctagcaacctgctgaaagctggtttcatccgccatacc
gtcaacaagatcacattctccgagcagtgctactacatctttggtgacctctgtggcaac
atggccaacctatcgcttcatgaccatgatggctccagtggcgcctctgaccaggacaca
ttggctcctttgccgcacccaggagctgccccttggcctatggctttcccttaccagtac
ccaccacctccgcatccctacaacccacacccaggcttcccagaactgggctacagctac
ggtgggggcagcgccagcagtcagcacagtgaaggcagtcgtagcagtggctccaaccga
agtggtagcgaccggcgcaaggagaaggacccaaaagctggggactccaagtcaggtggt
agcggcagcgagtcagaccacactactcgcagcagtctgagggggccacgggagcgggca
ccaagcgagcgatcaggcccagcggccagcgagcacagccaccgcagtcaccattcgctg
accagcagcctgcgcagccaccacacgcacccgagctatggtccacccggagtgccccct
ctttatggtcccccgatgctgatgatgaccccgccacccgcagccatggggcccccagga
gcccctccagggcgtgacctggcctcggtgcccccggaactgacggccagcagacagtcc
ttccgcatggcaatgggaaaccccaccaagaatttcgggctctttgactttctgtga

KEGG   Mus pahari (shrew mouse): 110331183
Entry
110331183         CDS       T05929                                 

Gene name
Dvl2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04150  mTOR signaling pathway
mpah04310  Wnt signaling pathway
mpah04330  Notch signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04916  Melanogenesis
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331183 (Dvl2)
   04330 Notch signaling pathway
    110331183 (Dvl2)
   04390 Hippo signaling pathway
    110331183 (Dvl2)
   04150 mTOR signaling pathway
    110331183 (Dvl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331183 (Dvl2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    110331183 (Dvl2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331183 (Dvl2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    110331183 (Dvl2)
   05226 Gastric cancer
    110331183 (Dvl2)
   05217 Basal cell carcinoma
    110331183 (Dvl2)
   05224 Breast cancer
    110331183 (Dvl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331183 (Dvl2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331183 (Dvl2)
   05022 Pathways of neurodegeneration - multiple diseases
    110331183 (Dvl2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331183 (Dvl2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 PDZ_2 Shufflon_N
Other DBs
NCBI-GeneID: 110331183
NCBI-ProteinID: XP_021067241
Ensembl: MGP_PahariEiJ_G0017744
LinkDB
Position
14
AA seq 736 aa
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDTPQPETAPPAHESRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESELSSRGGSLRRGGEPGGTGDGGPPPSRGSAGAPPNLRA
LPGLHPYGAPPGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcgcggggggcggtggtgtaggcgagacgaaggtgatttaccatctg
gatgaagaagagactccttacctggtgaagatccctgtcccggcggagcgcatcacgctc
ggcgatttcaagagcgttttgcagcggcccgcgggcgccaagtactttttcaagtctatg
gatcaggattttggggtggtgaaggaagagatctccgatgacaacgcccgcctaccttgt
ttcaatgggagggttgtctcctggctcgtgtcgtcagataccccccagcctgagacggct
cccccagcccatgagtctcggacagaactggttcccccacctccaccgttaccccctttg
ccaccagaaaggaccagtggcattggggactcaaggcctccgtccttccaccctaacgta
tccagcagccatgaaaatctagagcctgagacagagaccgaatctgtcgtatcactgagg
cgagaccgacctcggaggagagacagcagtgaacatggcgctggtggccacaggcctggt
ggcccctcaaggctggagcgccacctggcggggtatgagagctcttccaccctcatgacc
agtgagctggagagcaccagcctaggagactcggatgaggacgacaccatgagtaggttc
agcagctccaccgagcagagcagtgcctcccgcctcctcaagcgccaccgaaggcgaagg
aagcagcggccgccacgcatggagaggacttcatccttcagcagcgtcaccgattccacg
atgtctctcaatatcatcacggtcacactcaacatggagaagtacaacttcctgggcatc
tccattgtgggccaaagtaacgagcgtggtgacgggggcatctacatcggctccatcatg
aaagggggcgcggtggccgcagatgggcggatcgagcccggagacatgcttttgcaggta
aacgatatgaactttgagaacatgagcaacgacgatgctgtacgggtgctgagagacatt
gtacacaagccaggccccatcgtgctgaccgtggccaagtgttgggatccgtctccccag
gcctacttcaccctccctcgaaatgagcccatccagcccattgaccctgccgcctgggtg
tcgcactcggccgcgctgactggcgccttccccgcctaccccggctcctcatctatgagc
actatcacatctggctcctctctgcccgatggctgcgaaggccggggtctctctgtccac
atggacatggcctctgtcaccaaggctatggcagccccagagtctggactcgaagtccgg
gaccgaatgtggctcaagatcaccattccaaacgcctttctaggctccgatgtagtagac
tggctgtatcatcatgtggaaggttttcctgagcgccgggaggcccgcaagtacgccagt
gggctgttgaaggcgggactcatccggcacaccgtcaacaagattactttctctgagcag
tgctactatgtcttcggggacctcagtggtggctgtgagagttacctagttaacctgtct
ctgaatgacaatgacggttccagtggggcttcagaccaggataccctggctcctctgcct
ggagctactccctggccgctgctgccaaccttctcctaccagtatccagcgccacacccc
tacagcccccagcctccaccctaccacgagctttcctcctacacctatggtggaggcagt
gccagcagccagcacagtgaggggagtcggagcagcgggtcaacacgaagcgatgggggg
gccgggcgcacaggcaggcctgaggaacgggcccctgagtccaagtccggcagtggcagt
gagtcagaactctccagccggggaggcagccttcggcggggtggggagcctggtgggact
ggtgatggcggtccccctccatccaggggctcggcaggcgctcctcctaatctccgagct
cttcctgggctgcatccctacggagccccccctggcatggctctcccctataaccccatg
atggtagtcatgatgcctccgcccccaccccccgtctccacagcagtgcagccccctggt
gcccctccagtcagagacctgggctctgtgcccccagaactgacagctagccgtcagagc
ttccacatggctatgggcaaccccagtgagttttttgtggatgttatgtag

DBGET integrated database retrieval system