KEGG   Mus pahari (shrew mouse): 110323252
Entry
110323252         CDS       T05929                                 

Gene name
Jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01522  Endocrine resistance
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04024  cAMP signaling pathway
mpah04137  Mitophagy - animal
mpah04210  Apoptosis
mpah04310  Wnt signaling pathway
mpah04380  Osteoclast differentiation
mpah04510  Focal adhesion
mpah04530  Tight junction
mpah04620  Toll-like receptor signaling pathway
mpah04621  NOD-like receptor signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04657  IL-17 signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04662  B cell receptor signaling pathway
mpah04668  TNF signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah04912  GnRH signaling pathway
mpah04915  Estrogen signaling pathway
mpah04921  Oxytocin signaling pathway
mpah04926  Relaxin signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04933  AGE-RAGE signaling pathway in diabetic complications
mpah05030  Cocaine addiction
mpah05031  Amphetamine addiction
mpah05132  Salmonella infection
mpah05133  Pertussis
mpah05135  Yersinia infection
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05161  Hepatitis B
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05200  Pathways in cancer
mpah05203  Viral carcinogenesis
mpah05210  Colorectal cancer
mpah05211  Renal cell carcinoma
mpah05224  Breast cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mpah05321  Inflammatory bowel disease
mpah05323  Rheumatoid arthritis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110323252 (Jun)
   04012 ErbB signaling pathway
    110323252 (Jun)
   04310 Wnt signaling pathway
    110323252 (Jun)
   04668 TNF signaling pathway
    110323252 (Jun)
   04024 cAMP signaling pathway
    110323252 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    110323252 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    110323252 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110323252 (Jun)
   04530 Tight junction
    110323252 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110323252 (Jun)
   04621 NOD-like receptor signaling pathway
    110323252 (Jun)
   04625 C-type lectin receptor signaling pathway
    110323252 (Jun)
   04660 T cell receptor signaling pathway
    110323252 (Jun)
   04658 Th1 and Th2 cell differentiation
    110323252 (Jun)
   04659 Th17 cell differentiation
    110323252 (Jun)
   04657 IL-17 signaling pathway
    110323252 (Jun)
   04662 B cell receptor signaling pathway
    110323252 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110323252 (Jun)
   04915 Estrogen signaling pathway
    110323252 (Jun)
   04921 Oxytocin signaling pathway
    110323252 (Jun)
   04926 Relaxin signaling pathway
    110323252 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110323252 (Jun)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110323252 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323252 (Jun)
   05203 Viral carcinogenesis
    110323252 (Jun)
   05231 Choline metabolism in cancer
    110323252 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110323252 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110323252 (Jun)
   05211 Renal cell carcinoma
    110323252 (Jun)
   05224 Breast cancer
    110323252 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110323252 (Jun)
   05321 Inflammatory bowel disease
    110323252 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    110323252 (Jun)
   05031 Amphetamine addiction
    110323252 (Jun)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110323252 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110323252 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110323252 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110323252 (Jun)
   05135 Yersinia infection
    110323252 (Jun)
   05133 Pertussis
    110323252 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110323252 (Jun)
   05170 Human immunodeficiency virus 1 infection
    110323252 (Jun)
   05161 Hepatitis B
    110323252 (Jun)
   05171 Coronavirus disease - COVID-19
    110323252 (Jun)
   05162 Measles
    110323252 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323252 (Jun)
   05169 Epstein-Barr virus infection
    110323252 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110323252 (Jun)
   05142 Chagas disease
    110323252 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110323252 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110323252 (Jun)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    110323252 (Jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 110323252
NCBI-ProteinID: XP_021056061
Ensembl: MGP_PahariEiJ_G0028507
LinkDB
Position
6
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg
aacctggccgacccggtgggcaatctgaagccgcacctccgcgccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgcccgagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgtccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa
ctgcatagccagaacacgctgcccagtgtcacctccgcggcacagccggtcagcggggcg
ggcatggtggctcccgcggtagcctcagtagcaggcgctggcggcggcggcggctacagc
gccagtctgcacagtgagcctccggtgtacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccatcgcag
ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggttgcaggccctgaaggaagagccgcagacggtgccggagatgccggga
gagacgccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctggagcggatc
gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac
agtggatgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system