Mus pahari (shrew mouse): 110323252 Help Entry 110323252         CDS       T05929                                  Gene name Jun Definition (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mpah  Mus pahari (shrew mouse) Pathway mpah01522   Endocrine resistance mpah04010   MAPK signaling pathway mpah04012   ErbB signaling pathway mpah04024   cAMP signaling pathway mpah04137   Mitophagy - animal mpah04210   Apoptosis mpah04310   Wnt signaling pathway mpah04380   Osteoclast differentiation mpah04510   Focal adhesion mpah04530   Tight junction mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04625   C-type lectin receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04668   TNF signaling pathway mpah04722   Neurotrophin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04921   Oxytocin signaling pathway mpah04926   Relaxin signaling pathway mpah04932   Non-alcoholic fatty liver disease mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah05030   Cocaine addiction mpah05031   Amphetamine addiction mpah05132   Salmonella infection mpah05133   Pertussis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05161   Hepatitis B mpah05162   Measles mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05210   Colorectal cancer mpah05211   Renal cell carcinoma mpah05224   Breast cancer mpah05231   Choline metabolism in cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpah05321   Inflammatory bowel disease mpah05323   Rheumatoid arthritis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110323252 (Jun)    04012 ErbB signaling pathway     110323252 (Jun)    04310 Wnt signaling pathway     110323252 (Jun)    04668 TNF signaling pathway     110323252 (Jun)    04024 cAMP signaling pathway     110323252 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     110323252 (Jun)   09143 Cell growth and death    04210 Apoptosis     110323252 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     110323252 (Jun)    04530 Tight junction     110323252 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110323252 (Jun)    04621 NOD-like receptor signaling pathway     110323252 (Jun)    04625 C-type lectin receptor signaling pathway     110323252 (Jun)    04660 T cell receptor signaling pathway     110323252 (Jun)    04658 Th1 and Th2 cell differentiation     110323252 (Jun)    04659 Th17 cell differentiation     110323252 (Jun)    04657 IL-17 signaling pathway     110323252 (Jun)    04662 B cell receptor signaling pathway     110323252 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     110323252 (Jun)    04915 Estrogen signaling pathway     110323252 (Jun)    04921 Oxytocin signaling pathway     110323252 (Jun)    04926 Relaxin signaling pathway     110323252 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     110323252 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     110323252 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110323252 (Jun)    05203 Viral carcinogenesis     110323252 (Jun)    05231 Choline metabolism in cancer     110323252 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110323252 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     110323252 (Jun)    05211 Renal cell carcinoma     110323252 (Jun)    05224 Breast cancer     110323252 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     110323252 (Jun)    05321 Inflammatory bowel disease     110323252 (Jun)   09165 Substance dependence    05030 Cocaine addiction     110323252 (Jun)    05031 Amphetamine addiction     110323252 (Jun)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110323252 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     110323252 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     110323252 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     110323252 (Jun)    05135 Yersinia infection     110323252 (Jun)    05133 Pertussis     110323252 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110323252 (Jun)    05170 Human immunodeficiency virus 1 infection     110323252 (Jun)    05161 Hepatitis B     110323252 (Jun)    05171 Coronavirus disease - COVID-19     110323252 (Jun)    05162 Measles     110323252 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     110323252 (Jun)    05169 Epstein-Barr virus infection     110323252 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     110323252 (Jun)    05142 Chagas disease     110323252 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110323252 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpah03000]     110323252 (Jun) Transcription factors [BR:mpah03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     110323252 (Jun) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 TFIIA FlaC_arch NBP1 Fib_alpha DUF3450 Jnk-SapK_ap_N Motif Other DBs NCBI-GeneID:  110323252 NCBI-ProteinID:  XP_021056061 Ensembl:  MGP_PahariEiJ_G0028507 LinkDB All DBs Position 6 AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcacctccgcgccaagaactcggacctt ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgcccgagctggagcgcctgatc atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgtccc aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa ctgcatagccagaacacgctgcccagtgtcacctccgcggcacagccggtcagcggggcg ggcatggtggctcccgcggtagcctcagtagcaggcgctggcggcggcggcggctacagc gccagtctgcacagtgagcctccggtgtacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccatcgcag ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg cagcacccgcggttgcaggccctgaaggaagagccgcagacggtgccggagatgccggga gagacgccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgccgcctccaagtgccggaaaaggaagctggagcggatc gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac agtggatgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system