KEGG   Mus pahari (shrew mouse): 110323338
Entry
110323338         CDS       T05929                                 

Gene name
Casp9
Definition
(RefSeq) caspase-9 isoform X1
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04115  p53 signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04370  VEGF signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah05010  Alzheimer disease
mpah05012  Parkinson disease
mpah05014  Amyotrophic lateral sclerosis
mpah05016  Huntington disease
mpah05020  Prion disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05134  Legionellosis
mpah05145  Toxoplasmosis
mpah05152  Tuberculosis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05215  Prostate cancer
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    110323338 (Casp9)
   04151 PI3K-Akt signaling pathway
    110323338 (Casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110323338 (Casp9)
   04215 Apoptosis - multiple species
    110323338 (Casp9)
   04115 p53 signaling pathway
    110323338 (Casp9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110323338 (Casp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323338 (Casp9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110323338 (Casp9)
   05212 Pancreatic cancer
    110323338 (Casp9)
   05215 Prostate cancer
    110323338 (Casp9)
   05213 Endometrial cancer
    110323338 (Casp9)
   05222 Small cell lung cancer
    110323338 (Casp9)
   05223 Non-small cell lung cancer
    110323338 (Casp9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323338 (Casp9)
   05012 Parkinson disease
    110323338 (Casp9)
   05014 Amyotrophic lateral sclerosis
    110323338 (Casp9)
   05016 Huntington disease
    110323338 (Casp9)
   05020 Prion disease
    110323338 (Casp9)
   05022 Pathways of neurodegeneration - multiple diseases
    110323338 (Casp9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110323338 (Casp9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    110323338 (Casp9)
   05152 Tuberculosis
    110323338 (Casp9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323338 (Casp9)
   05161 Hepatitis B
    110323338 (Casp9)
   05160 Hepatitis C
    110323338 (Casp9)
   05164 Influenza A
    110323338 (Casp9)
   05162 Measles
    110323338 (Casp9)
   05168 Herpes simplex virus 1 infection
    110323338 (Casp9)
   05163 Human cytomegalovirus infection
    110323338 (Casp9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323338 (Casp9)
   05169 Epstein-Barr virus infection
    110323338 (Casp9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110323338 (Casp9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110323338 (Casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110323338 (Casp9)
   01002 Peptidases and inhibitors [BR:mpah01002]
    110323338 (Casp9)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     110323338 (Casp9)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110323338 (Casp9)
Peptidases and inhibitors [BR:mpah01002]
 Cysteine peptidases
  Family C14: caspase family
   110323338 (Casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 110323338
NCBI-ProteinID: XP_021056163
Ensembl: MGP_PahariEiJ_G0029085
LinkDB
Position
6
AA seq 454 aa
MDEADRQLLRRCRVRLVSELQVAELWDALLSRELFTRDMIEDIQQAGSGCRRDQARQLVT
DLETRGRQALPLFISCLEDTGQGTLASFLQSSRQAAKQDPEAVKPLGHLVPVVLGPMGLT
AKKQRVVKLDPSQPALGNLTPVVLGPEELWPARLKPEVLRPETPRPVDIGSGGAHDVCVP
GKARGHADMAYTLDSDPCGHCLIINNVNFCPSSGLGTRTGSSVDCDKLERRFRWLHFMVE
VKSDLTGKKMITALMEMARRDHRALDCFVVVILSHGCQASHLQFPGAVYGTDGCSVSIEK
IVNIFNGSGCPSLGGKPKLFFIQACGGEQKDHGFEVACTSSQGRDFDSDSEPDAVPYQEG
PRSLDQLDAVSSLPTPSDILVSYSTFPGFVSWRDKKSGSWYIETLDGILEQWARSEDLQS
LLLRVANAVSEKGIYKQIPGCFNFLRKKLFFKTS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggacgaggcggaccggcagctcctgcggcgatgcagggtgcgcctagtgagcgagctg
caagtcgcggagctctgggacgctctgctgagtcgagagctcttcacgcgcgacatgatc
gaggatattcagcaggcaggctctgggtgtcggcgggatcaggccaggcagctggtcaca
gatcttgagacccgagggaggcaggcccttcctctcttcatctcctgcttagaggacaca
ggccaaggcaccctggcttcattcttgcaaagcagtcggcaagcagccaagcaggatcca
gaggctgttaaacccctaggccacctggtgcctgtggtcctgggaccaatgggacttaca
gcaaagaagcagagagtagtgaagctggacccgtcacagcctgccctgggaaacctcacc
ccagtggtgctggggcccgaagagctctggcctgctcggctcaagccagaggttctcaga
ccagaaacacccaggccggtggacattggttctggcggagctcatgatgtctgtgttcca
gggaaggccaggggacatgcagacatggcatacaccctggattcggatccctgtggccac
tgcctcatcatcaacaatgtgaacttctgcccttcctcggggctcggcacgcgcaccggc
tccagcgtggactgtgacaagcttgagcgtcgcttccgctggctgcacttcatggtggag
gtgaagagcgacctgactggcaagaaaatgatcacagctctgatggagatggcgcgccgg
gaccatcgtgccctggactgctttgtggtggtcatcctctctcatggctgccaggccagc
cacctacagttcccaggtgccgtctatgggacagatggatgttccgtgtccattgagaaa
attgtgaacatcttcaacgggagcggctgccctagcctgggagggaagcccaagctcttc
ttcatccaggcctgcggtggtgagcagaaagaccatggctttgaggtggcctgcacttcc
tctcaaggcagggacttcgacagtgactctgaaccagatgctgtcccatatcaggaaggc
ccaaggtccttggaccagctggatgctgtgtcgagtttgcctacccccagtgacatcctt
gtgtcctactccacattcccaggctttgtctcctggagggacaagaaaagcggctcctgg
tacatcgagaccttggatggcattctggagcagtgggctcgctctgaagacctgcagtcc
ctccttctcagggtcgccaatgctgtttctgagaaagggatttataagcagattcctggc
tgctttaacttcctccggaaaaagctgttttttaaaacttcctga

DBGET integrated database retrieval system