KEGG   Mus pahari (shrew mouse): 110323363
Entry
110323363         CDS       T05929                                 

Gene name
Mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01521  EGFR tyrosine kinase inhibitor resistance
mpah01522  Endocrine resistance
mpah04012  ErbB signaling pathway
mpah04066  HIF-1 signaling pathway
mpah04072  Phospholipase D signaling pathway
mpah04136  Autophagy - other
mpah04140  Autophagy - animal
mpah04150  mTOR signaling pathway
mpah04151  PI3K-Akt signaling pathway
mpah04152  AMPK signaling pathway
mpah04211  Longevity regulating pathway
mpah04213  Longevity regulating pathway - multiple species
mpah04218  Cellular senescence
mpah04371  Apelin signaling pathway
mpah04613  Neutrophil extracellular trap formation
mpah04630  JAK-STAT signaling pathway
mpah04659  Th17 cell differentiation
mpah04714  Thermogenesis
mpah04910  Insulin signaling pathway
mpah04919  Thyroid hormone signaling pathway
mpah04920  Adipocytokine signaling pathway
mpah04930  Type II diabetes mellitus
mpah04931  Insulin resistance
mpah04935  Growth hormone synthesis, secretion and action
mpah05010  Alzheimer disease
mpah05014  Amyotrophic lateral sclerosis
mpah05016  Huntington disease
mpah05017  Spinocerebellar ataxia
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05163  Human cytomegalovirus infection
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05214  Glioma
mpah05215  Prostate cancer
mpah05221  Acute myeloid leukemia
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
mpah05230  Central carbon metabolism in cancer
mpah05231  Choline metabolism in cancer
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110323363 (Mtor)
   04371 Apelin signaling pathway
    110323363 (Mtor)
   04630 JAK-STAT signaling pathway
    110323363 (Mtor)
   04066 HIF-1 signaling pathway
    110323363 (Mtor)
   04072 Phospholipase D signaling pathway
    110323363 (Mtor)
   04151 PI3K-Akt signaling pathway
    110323363 (Mtor)
   04152 AMPK signaling pathway
    110323363 (Mtor)
   04150 mTOR signaling pathway
    110323363 (Mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110323363 (Mtor)
   04136 Autophagy - other
    110323363 (Mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    110323363 (Mtor)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110323363 (Mtor)
   04659 Th17 cell differentiation
    110323363 (Mtor)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110323363 (Mtor)
   04920 Adipocytokine signaling pathway
    110323363 (Mtor)
   04935 Growth hormone synthesis, secretion and action
    110323363 (Mtor)
   04919 Thyroid hormone signaling pathway
    110323363 (Mtor)
  09149 Aging
   04211 Longevity regulating pathway
    110323363 (Mtor)
   04213 Longevity regulating pathway - multiple species
    110323363 (Mtor)
  09159 Environmental adaptation
   04714 Thermogenesis
    110323363 (Mtor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110323363 (Mtor)
   05206 MicroRNAs in cancer
    110323363 (Mtor)
   05205 Proteoglycans in cancer
    110323363 (Mtor)
   05230 Central carbon metabolism in cancer
    110323363 (Mtor)
   05231 Choline metabolism in cancer
    110323363 (Mtor)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110323363 (Mtor)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110323363 (Mtor)
   05212 Pancreatic cancer
    110323363 (Mtor)
   05225 Hepatocellular carcinoma
    110323363 (Mtor)
   05226 Gastric cancer
    110323363 (Mtor)
   05214 Glioma
    110323363 (Mtor)
   05221 Acute myeloid leukemia
    110323363 (Mtor)
   05215 Prostate cancer
    110323363 (Mtor)
   05224 Breast cancer
    110323363 (Mtor)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110323363 (Mtor)
   05014 Amyotrophic lateral sclerosis
    110323363 (Mtor)
   05016 Huntington disease
    110323363 (Mtor)
   05017 Spinocerebellar ataxia
    110323363 (Mtor)
   05022 Pathways of neurodegeneration - multiple diseases
    110323363 (Mtor)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110323363 (Mtor)
   04931 Insulin resistance
    110323363 (Mtor)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110323363 (Mtor)
   05168 Herpes simplex virus 1 infection
    110323363 (Mtor)
   05163 Human cytomegalovirus infection
    110323363 (Mtor)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110323363 (Mtor)
   05165 Human papillomavirus infection
    110323363 (Mtor)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110323363 (Mtor)
   01522 Endocrine resistance
    110323363 (Mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110323363 (Mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110323363 (Mtor)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110323363 (Mtor)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   110323363 (Mtor)
Membrane trafficking [BR:mpah04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    110323363 (Mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 110323363
NCBI-ProteinID: XP_021056193
Ensembl: MGP_PahariEiJ_G0029148
LinkDB
Position
6
AA seq 2549 aa
MLGTGPAVATASAATSSNVSVLQQFASGLKSRNEETRVKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQPNALVGLLGYSSPQGLMGFGTSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSSQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKEDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATSTEGSNSESEAESNDNSP
TPSPLQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKAGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgctcgggacgggtcctgccgtggccaccgccagtgccgccacatctagcaacgtgagt
gtcctgcagcagttcgccagtggactgaagagccggaatgaggagaccagggtcaaagca
gccaaggagctccagcactacgtcaccatggagctccgagagatgagtcaggaggagtct
actcgattctatgaccagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaagggtggcatcttggccatcgccagcctcataggagtggaaggtgggaat
tccaccagaattggcagatttgccaactatcttcggaacctcctcccctcaagcgatcca
gttgtcatggaaatggcgtccaaggccatcggccgcctggctatggcaggggacactttc
actgcggagtatgtggagtttgaggtgaagcgagccttggagtggctgggtgctgaccga
aatgagggccggagacatgccgctgtcctcgttctccgtgagctggccatcagtgtcccc
accttcttcttccagcaagttcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatccgggaaggagctgtggcggcccttcgtgcctgtctgattctcacc
acgcagcgggaaccaaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaaaggttttgatgagaccctggccaaagagaagggtatgaatcgagatgatcga
atccatggagccttgctgatcctcaacgagctagttcgtatcagcagcatggagggagag
cgtctgagagaagagatggaggagatcacccagcagcagctggtacatgacaagtactgc
aaagacctgatgggctttgggacaaagcctcggcacatcacacccttcaccagtttccag
gctgtgcagccccagcagccgaacgccttggtgggactgctggggtacagctccccccaa
ggcctgatgggatttgggacgtcccccagccctgccaagtccactctggtggaaagccgc
tgttgcagagacttgatggaagagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggagcagcaagaactcgctgatccagatgactatccttaacctgctaccccgcctggct
gcattccgaccgtcggccttcacagatacccagtacctccaggacaccatgaaccatgtc
ctgagctgtgtcaagaaggagaaggaacggactgcggcgttccaggccctggggctgctt
tcggtggcagtgaggtcggagtttaaggtctacctgccccgtgtacttgacatcatccga
gctgccctgcctccgaaggactttgcccacaagaggcagaaaaccgtgcaggtggatgcc
acagtattcacgtgcatcagcatgctggcgcgagcaatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgttggcagtgggcctgagccccgcgctcactgctgtg
ctctatgacctgagcaggcagattccgcagctgaagaaagatattcaggacggccttctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaaaggc
ctggcccaccagctggcttcccctggtctcactaccctccctgaggccagtgacgtggcc
agcattactcttgcccttcgaacccttggcagctttgaatttgaaggccactctctgacc
cagttcgtccgacactgcgcagatcacttcctgaacagcgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagcggccac
gcccacgtggtcagccagacggcagtgcaggtggtggctgatgtgctcagcaagctgctt
gtggtcggcataacagatcctgaccctgatatccgctactgtgtcttggcatccctggac
gagcgttttgatgcccatctggcccaggcagaaaacttacaagctctgtttgtggctctg
aatgaccaggtctttgagatccgcgagctggccatctgcactgtgggccgactaagcagc
atgaacccagccttcgtaatgcctttcctgcgcaagatgctcatccagatcctgacagag
ctggaacacagcggtattgggagaatcaaggagcagagcgcccgcatgctggggcacctg
gtctccaacgcgccccggctcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgacccaaacccgggcgtgatcaataacgtgttggcc
actataggagaactggctcaggtgagcggcctggaaatgaggaagtgggtggatgagctc
tttatcatcatcatggacatgctccaggactcctccctgctggccaaaaggcaggtggct
ttgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
taccccactctgcttgaagtgctgctgaattttctgaagacagagcagaaccagggcact
cggagagaggctatccgagtgttggggctccttggggctttggatccctacaagcacaaa
gtgaacatcggcatgatcgaccagtcccgggacgcttccgctgtcagcctgtcagagtcc
aagtcaagccaggattcctctgactacagcaccagtgaaatgctggtcaacatgggaaat
ctgcccctggacgagttctaccccgctgtgtccatggtggccttgatgcggatcttccga
gatcagtccctctctcaccaccacaccatggtggtgcaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattccttaatgtc
atccgagtctgtgacggggccatccgggagtttctgttccagcagctggggatgctggtg
tcctttgtgaagagccacatccgtccctacatggatgaaatagtcaccctcatgagggaa
ttttgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaattgta
gtggctcttggaggtgaatttaagctctatctgccccagctgatcccacacatgctacgg
gtcttcatgcatgacaacagccaaggccgcatcgtctccatcaagctgttagcagcgatc
cagctgtttggcgccaacctggatgactatctgcacttgttgttgcctccgattgtgaaa
ttgtttgatgcccctgaagtcccactgccatcgagaaaggcagcgctggagacggtggac
cgcctgacggagtccctagatttcactgactacgcctcccgcatcattcacccgatcgtt
cgtacgctagaccagagcccagagctgcgctccacagccatggacacactgtcttcactt
gtctttcaactggggaagaagtaccaaatcttcattccaatggtgaataaagtccttgtg
agacaccggatcaaccaccagcgctacgacgtgcttatctgcagaatcgtcaaggggtac
acacttgctgatgaagaggaggaccctttgatttaccagcatcgaatgctgaggagcagc
cagggagatgccctggccagtgggccagttgagacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaggacgactgg
ctggagtggctgaggcgcttgagtctggagcttctgaaggattcctcatcgccctccctg
cgttcatgctgggccttggcgcaggcctacaaccccatggccagggatctcttcaatgct
gcctttgtgtcctgctggtctgagctgaatgaagaccaacaagatgagctcatcaggagt
attgagttggctctcacgtctcaagacattgctgaagtcacacaaaccctcctgaacttg
gctgagttcatggagcacagtgacaagggccccctgccactgagagatgacaatggcatc
gtgctactgggtgagagagctgctaagtgccgggcgtatgccaaagcactgcactacaaa
gaactggagttccagaaagggcccacacctgccatacttgagtccctcatcagcattaac
aataagctacagcagcctgaggcagcttctggggtgttggaatatgccatgaaacacttc
ggcgagctggagatccaggccacctggtatgagaagctgcatgagtgggaggatgctctc
gtggcctacgacaagaagatggacacaaacaaggaagacccggagctgatgctgggccgc
atgcgctgcctcgaggccttgggggaatggggccagcttcatcagcagtgctgtgaaaag
tggactctggttaatgatgagacccaggctaagatggcccggatggctgctgctgcagcg
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatccctcgggacacc
cacgacggggccttttacagggcagtgttggctttacatcaggatcttttctccttggcc
caacagtgcattgacaaggccagggacctgttggatgcagagctgactgccatggcagga
gagagctacagccgagcctacggggccatggtttcttgccacatgctgtcggagctggag
gaggttattcagtacaaactcgtccctgagcgtcgggagatcatccggcagatctggtgg
gagagactgcagggctgccagcgtattgtagaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcacgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagcggcagactggctcttgctcataaaaccttagtgttgctcttgggagttgat
ccatctcggcaacttgaccatcctctgccaacagctcaccctcaagtgacctatgcctac
atgaagaacatgtggaaaagcgctcggaagatcgacgccttccagcacatgcagcacttt
gtacagaccatgcagcagcaggcccagcatgccatcgccacagaggaccagcagcacaag
caggagctgcataagctcatggccaggtgttttctgaaacttggggagtggcagctgaac
ctccagggcatcaatgagagtaccatccccaaggtgctgcagtactacagtgccgccaca
gagcacgaccgcagctggtacaaggcttggcacgcatgggcggtgatgaactttgaagca
gtgctacactacaaacatcagaaccaagcccgtgatgagaagaagaagctgcgtcacgcc
agcggggccaacatcaccaatgccaccactgcagccaccactgcagcctctgctgctgct
gccaccagcacggagggcagcaacagtgagagtgaagctgagagcaacgacaacagcccc
accccgtcccctctgcagaagaaggtcaccgaggatttatccaaaaccctcttgttgtac
actgtccctgctgttcaaggcttcttccgttctatctccttgtcaagaggcaacaacctc
caggatacactcagagtcctcaccttgtggtttgattatggtcactggccagatgtcaat
gaagccttggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctcattgcaagaattgacacccccagacccttggtgggccggctcattcaccagctt
ctcacagatattggtcggtaccacccacaggccctcatctaccccctgacggtggcttct
aaatctaccaccacagcccgtcacaatgcagccaacaagatcttgaagaacatgtgtgag
cacagcaacacgctggtccagcaggccatgatggtgagcgaagagctgattcgggtagcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcatctcgcttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcacgctatgatggaacgg
ggtccccagactctgaaggaaacgtcctttaatcaggcatatggccgagatttaatggag
gcacaagaatggtgtcgaaagtacatgaagtcggggaatgtcaaggacctcacgcaagcc
tgggacctctactatcatgtgttcagacggatctctaagcagctaccccagctcacgtcc
ttagagctgcagtatgtgtcccccaaacttctgatgtgccgggaccttgagttggctgtg
ccaggaacatatgaccccaaccagccaatcattcggattcaatccatagccccgtctttg
caagtcatcacatccaagcagaggcctcggaagctgactctgatgggcagcaatgggcat
gagtttgttttcctcctgaaaggccatgaagatctgcggcaggatgaacgagtgatgcag
ctctttggcctggtgaacacactcctagccaatgacccaacttctcttcgcaagaacctc
agcatccagagatacgctgtcatccctctgtccaccaactcgggcctcattggctgggtg
ccccactgtgacacactgcatgccctcatccgggactacagagagaagaagaagatcctg
ttgaacattgagcatcgcatcatgctgcggatggctcctgactatgaccacctgactttg
atgcagaaggtagaggtgtttgagcatgctgtcaacaacacagctggggacgacctggcc
aaactactgtggctgaaaagtcccagctcagaggtgtggtttgaccgaagaaccaactat
acccgctccctggctgttatgtcgatggtcggatacattttaggccttggagacaggcac
ccatccaacctgatgctggaccggctgagtggaaagatcctgcacattgactttggggac
tgctttgaggtcgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacgggtctggatggcaactacagaaccacatgc
cacacagtgatggaggtgcttcgggaacacaaggacagtgtcatggctgtgctggaagcc
tttgtttatgaccctctgctcaactggaggctgatggacacgaataccaaaggcaataag
cggtcccggacaaggacagactcctactctgcaggccagtcagtagaaattttggacggt
gtagaacttggagaaccagcccataagaaagcagggaccactgtgccagaatccatccat
tctttcattggagacggtttggtaaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagctcactggtcgggatttctctcatgatgacactttggat
gttccaacccaagtggagctgcttatcaagcaagcaacatctcacgagaacctctgccag
tgctacattggctggtgtcccttctggtaa

DBGET integrated database retrieval system