KEGG   Mus pahari (shrew mouse): 110324171
Entry
110324171         CDS       T05929                                 

Gene name
Cebpa
Definition
(RefSeq) CCAAT/enhancer-binding protein alpha
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04932  Non-alcoholic fatty liver disease
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110324171 (Cebpa)
   05202 Transcriptional misregulation in cancer
    110324171 (Cebpa)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110324171 (Cebpa)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110324171 (Cebpa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110324171 (Cebpa)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    110324171 (Cebpa)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin TolA_bind_tri bZIP_Maf GAS Hema_stalk Lipoprotein_20 DivIC
Other DBs
NCBI-GeneID: 110324171
NCBI-ProteinID: XP_021057152
Ensembl: MGP_PahariEiJ_G0012813
LinkDB
Position
1
AA seq 359 aa
MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHAAPALGAA
GLPGPGSALKGLAGAHPDLRTGGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKS
RDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agccccccgcacgcgcccagcaacgccgcctttggctttccccggggcgcgggccccgcg
ccgcccccagccccacctgccgccccggagccgctgggcggcatctgcgagcacgagacg
tctatagacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctcttccagcacagccggcagcaggagaaggccaaggcggcggcgggccccgcgggtggc
ggcggtgactttgactacccgggcgccccggcgggccccggcggcgcggtcatgtccgcg
ggggcgcacgggccccctcccggctacggctgtgcggcggccggctacctggacggcagg
ctggagcccctgtacgagcgcgtcggggcgccggcgctacggccgctggtgatcaagcag
gagccccgcgaggaggacgaggcgaagcagctggcgctggccggcctcttcccctatcag
ccgccgccgccaccgccgccgccgcacccgcacgcgtctcccgcgcacctggccgccccc
cacttgcagttccagatcgcgcactgcggccagaccaccatgcacctgcagcctggccac
cccacaccgccgcccacgcccgtgcctagcccgcacgctgcgcccgccttgggtgctgcg
ggcctgccgggccccgggagcgcgctcaagggcttggccggtgcgcacccggacctccgc
acgggtggcggcggcggtggcggcggtgccggtgcgggcaaggccaagaagtcggtggac
aagaacagcaacgagtaccgggtacggcgggaacgcaacaacatcgcggtgcgcaagagc
cgagataaagccaaacagcgcaacgtggagacgcaacagaaggtgctggagttgaccagt
gacaatgaccgcctgcgcaagcgggtggaacagctgagccgtgaactggacacgctgcgg
ggcatcttccgccagctgcctgagagctccttggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system